KEGG   Serratia sp. SCBI: SERRSCBI_18870Help
Entry
SERRSCBI_18870    CDS       T03314                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sers  Serratia sp. SCBI
Pathway
sers00061  Fatty acid biosynthesis
sers00780  Biotin metabolism
sers01100  Metabolic pathways
sers01212  Fatty acid metabolism
Module
sers_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sers00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SERRSCBI_18870
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SERRSCBI_18870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sers01004]
    SERRSCBI_18870
Enzymes [BR:sers01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SERRSCBI_18870
Lipid biosynthesis proteins [BR:sers01004]
 Fatty acid synthase
  Component type
   SERRSCBI_18870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AIM23346
LinkDB All DBs
Position
complement(4020924..4021379)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLDIAEILDLLPHRYPFLLVDRVLEFEEHKYLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMVMEVTFEKT
RRGLTRFKGVATVDGKIVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctggatattgcagaaattttggatctgcttcctcaccgt
tacccgttcttgctggtcgaccgcgtcctcgagtttgaagagcacaaatatctgcgtgcg
gtgaagaacgtatcggtgaatgaaccgtttttccagggccacttccctggcaaaccgatt
ttcccaggcgtattgatcctggaagccatggcgcaggccaccggcatcctggcgtttaaa
agcgtcggcaaactggaaccgggcgagctgtattacttcgccggtatcgatgaagctcgc
ttcaagcgccctgtggtgccaggcgatcagatggtcatggaagtcaccttcgagaaaact
cgccgcggtctgactcgcttcaaaggcgtggcgactgttgacggtaaaattgtctgcgaa
gcaaccatgatgtgtgcccgcagccgggaggcttaa

DBGET integrated database retrieval system