KEGG   Serratia sp. SCBI: SERRSCBI_20575Help
Entry
SERRSCBI_20575    CDS       T03314                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sers  Serratia sp. SCBI
Pathway
sers00250  Alanine, aspartate and glutamate metabolism
sers00410  beta-Alanine metabolism
sers00640  Propanoate metabolism
sers00650  Butanoate metabolism
sers01100  Metabolic pathways
sers01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sers00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SERRSCBI_20575
   00650 Butanoate metabolism
    SERRSCBI_20575
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SERRSCBI_20575
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SERRSCBI_20575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sers01007]
    SERRSCBI_20575
Enzymes [BR:sers01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SERRSCBI_20575
Amino acid related enzymes [BR:sers01007]
 Aminotransferase (transaminase)
  Class III
   SERRSCBI_20575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIM23681
LinkDB All DBs
Position
complement(4410069..4411334)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGVGVMCGFYAERAENATLWDVEGKEVIDFASGIAVLNTGHRHPK
VIAAIEKQLQAFTHTAYQIVPYESYVSLAERINQRAPIAGPCKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLDRLFKADIDPKQVAAIVLEPVQGEGGFNVAPADFMQALRALCDQHGILLIADEV
QTGFARTGKLFAMEHYSVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEQLCQRAQRLGQHLVEVLQQAHKTSPAIADVRAQGSMVAVEFND
PVTGKPSAEITRQVQQKAMEEGLLLLSCGVNGNVIRFLYPLTIPDDQFTKAMGILSRALA
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaattgaaccaacgccgtcaggacgccaccccgcgcggagtgggcgtg
atgtgtggtttttacgccgagcgcgcagagaacgccacgctgtgggatgtggaaggcaaa
gaagtgatcgactttgcttcggggatcgccgtgctgaacaccgggcaccgtcacccgaag
gtgatcgccgcaattgaaaagcagctgcaggccttcacccacaccgcctatcagatcgtt
ccttacgaaagctatgtttctttggcggagcgcatcaaccagcgcgcgccgatcgccggt
ccgtgtaaaaccgctttcttcaccaccggcgcggaagcggtggaaaacgcggtgaagatc
gcccgcgcttacactggccgtccgggcttgatcaccttcggcggcggcttccacggccgc
acctatatgaccatggcgctgaccggcaaagtggcgccttacaaactgggctttggccca
ttccccggctcggtgttccacggccagtacccgaacgcgctgtacggcgtgaccaccgaa
gacgcgatgaacagcctggatcgcctgtttaaagcggatatcgatcccaaacaggtggcg
gccattgtgctggagccggtgcagggcgagggcggtttcaacgtggcgccggccgatttc
atgcaggcgctgcgcgcgctgtgcgaccagcacggcatcctgctgatcgccgacgaagtg
cagaccggcttcgcccgtaccggcaagctgttcgccatggagcactacagcgttaagccc
gatttgatcactatggcgaaaagcctggcgggcggcatgccgctgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggcgggctgggcggcacctatgccggtaac
ccgctggcggtggccgccgcgcacgcggtgctggacgtgatcgacgaagagcagctgtgc
cagcgcgctcagcgcttgggtcagcacctggtggaagtgctccagcaggcgcacaaaacc
agcccggcgatcgccgatgtgcgcgcgcagggatcgatggtggcggtggagttcaacgat
ccggttaccggcaagccttcggcggagatcacccgtcaggtgcagcagaaggcgatggag
gaagggctgctgctgctgagctgcggcgtgaacggcaacgtgatccgcttcctctacccg
ctgaccatcccggacgatcagttcaccaaggcgatgggcattctgtcccgcgcgctggcc
cactaa

DBGET integrated database retrieval system