KEGG   Serratia sp. SCBI: SERRSCBI_21250Help
Entry
SERRSCBI_21250    CDS       T03314                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sers  Serratia sp. SCBI
Pathway
sers00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sers00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SERRSCBI_21250
Enzymes [BR:sers01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SERRSCBI_21250
Transporters [BR:sers02000]
 Other Transporters
  Pores ion channels [TC:1]
   SERRSCBI_21250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AIM23808
LinkDB All DBs
Position
complement(4556629..4557297)
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNHSRSQRILWFLEELGVPYQVQRYERDPHTLLAPPALKKIHPLGKSPVIVDGD
LTLAESGAIVEYLQEAYDAQGMFMPTDFHARQQYRYWLHYAEGSLMPLLVMKLVFSRLGQ
PPIPWLLRPVAGAIGKGVQREYLDKQIAPHCEYLEQHLNKGSWFVGNDFSAADIQMSFPL
EAMAARGALDNCPKLRGFLQRIHARPAYQRALEQGGPYDLLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgttcatcatctcaatcactcgcggtcgcagcgcattctgtggtttttggaa
gagctgggcgtgccctatcaggtgcaacgttacgagcgcgatccgcacactctgctggcg
ccgccggcgctgaaaaagatccatccgctgggcaaatcgccggtgatcgtcgatggcgat
ctgacgctggcggaatccggcgccattgtcgaatacttgcaggaagcctacgacgcacag
ggcatgtttatgccgacggacttccacgcgcgccagcaataccgctactggttgcactac
gctgagggatcgctgatgccgctgttggtgatgaagctggtgttcagccgtctcggccag
ccgccgatcccctggctgctgcggccggtggcgggcgcgatcggcaagggcgtacagcgc
gaatacctcgacaaacagatcgcgccgcactgcgagtatctcgaacagcacctgaacaag
ggcagctggttcgtcggcaacgatttcagcgcggcggacatacagatgagctttccgctc
gaggcgatggcggcgcgcggcgcgttggacaattgcccgaaactgcgcggcttcctgcag
cgcatccacgcccggcccgcttaccagcgggcgctggaacagggcggcccttacgacctg
ctgagttaa

DBGET integrated database retrieval system