KEGG   Serinicoccus sp. W204: FY030_04580Help
Entry
FY030_04580       CDS       T06221                                 

Definition
(GenBank) hypothetical protein
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
serw  Serinicoccus sp. W204
Pathway
serw03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:serw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    FY030_04580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:serw03400]
    FY030_04580
Enzymes [BR:serw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     FY030_04580
DNA repair and recombination proteins [BR:serw03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     FY030_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: QFG70148
UniProt: A0A5J6V8M6
LinkDB All DBs
Position
1016877..1017578
Genome map
AA seq 233 aa AA seqDB search
MVIAGSPSTAHGAVWRGVTVGLSAVRRRSLTVEKKPTPKKPTPKKPTPKKEHAVDVLDDL
LDHDLRLVVVGTAVGDCAARRGHYYAGPGQSFWTLLARAGLTPRVLPPPDDATLVEHGIG
LTDLVKIEAQSHGRQLVFDVPSLAAKLSEHRPRWVAFNGKVAATHCARWAGHRPPGLGLQ
DWTFAGAPVFVLPSSSGANRRRDYDGRPDRESWWEDLGTLVRKEDQPTQATSA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ctggtcatcgcaggctcgccatcgactgctcacggggcagtttggcgaggagtgacagtc
ggtctgtcagccgtccggcggcgtagcctgacggttgagaagaaaccaacaccgaagaaa
ccaacaccgaagaaaccaacaccgaagaaggagcacgcggtggacgtcctggacgacctg
ctcgaccacgacctgcggcttgtcgtcgtcgggacggcagtgggggactgtgctgcgcgc
cggggccactactacgccgggcccggccagtcgttctggaccctgctcgcgcgcgccggg
ctcacaccgcgggtgctcccgccgcccgacgacgccaccctggtcgagcacggcatcggg
ctcaccgacctggtcaagatcgaggcgcagtcgcacggccgtcagctggtcttcgacgtc
cccagcctggccgccaagctctcggagcaccggccccggtgggtcgccttcaacggcaag
gtcgccgcgacccactgcgcccggtgggcgggtcaccggcctcccgggcttggcctgcag
gactggacgttcgccggcgccccggtgttcgtgctgcccagcagctcgggggcgaaccgg
cgccgcgactacgacggccggcccgaccgggagtcctggtgggaggaccttggcaccctc
gtcaggaaggaggaccagccgacgcaggccaccagcgcctga

DBGET integrated database retrieval system