KEGG   Salmonella enterica subsp. arizonae: SARI_00181Help
Entry
SARI_00181        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00250  Alanine, aspartate and glutamate metabolism
ses00280  Valine, leucine and isoleucine degradation
ses00310  Lysine degradation
ses00410  beta-Alanine metabolism
ses00640  Propanoate metabolism
ses00650  Butanoate metabolism
ses01100  Metabolic pathways
ses01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SARI_00181
   00650 Butanoate metabolism
    SARI_00181
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SARI_00181
   00280 Valine, leucine and isoleucine degradation
    SARI_00181
   00310 Lysine degradation
    SARI_00181
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SARI_00181
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ses01007]
    SARI_00181
Enzymes [BR:ses01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SARI_00181
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SARI_00181
    2.6.1.48  5-aminovalerate transaminase
     SARI_00181
Amino acid related enzymes [BR:ses01007]
 Aminotransferase (transaminase)
  Class III
   SARI_00181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABX20128
UniProt: A9MG20
LinkDB All DBs
Position
complement(165677..166960)
Genome map
AA seq 427 aa AA seqDB search
MNTNKALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCPLHGISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEHENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPSKPNATLTADIVARARDKGLILLSCGPYYNILRILVPLTIDASQIRQGLEIIAQC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataaagcattaatgcagcgccgtcataacgccgttccccgcggcgtgggt
cagattcaccctattttcgccgagcgggcggaaaattgtcgagtctgggatgttgaaggc
cgcgagtatctcgatttcgcgggcggcatcgccgttctgaacaccggccatttacatcca
ggcattgtttcagcggtcgaagcgcaattgaagaaactgtcgcatacctgttttcaggtg
ctggcctatgaaccgtacctggcgctgtgcgaacgcatgaatcagaaagtgccaggcgat
ttcgccaaaaaaacgctgctggtcacgaccggttccgaagcggttgaaaacgcggtgaaa
atcgcccgcgcggcaaccaaacgcagcggcgctatcgcttttagcggcgcttatcacggt
cgtacccactacacgctctctctgaccgggaaagtaaatccttactccgctggcatgggg
ttgatgccgggccatgtctaccgtgcgctttatccttgcccgttgcatggcatcagcgac
gacgacgcgatcgccagtattgagcgtatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgctgatcgccgacgag
gtgcaaagcggcgcggggcgtaccggtacgctattcgccatggaacagatgggcgtagcg
gcagatatcaccacttttgcaaaatcgatcgctggcggctttccgctggcaggcgtcacc
ggtcgggcggaagtgatggatgccatcgcgccgggcggtctcggcggcacctatgcagga
aacccaattgcctgcgccgccgcgctggcggtactggatattttcgagcacgaaaatctg
ctgcaaaaggcgaatacgcttggcaaaacgctacgtgatggtctgatggaaatagcggaa
acgcaccgtgagatcggcgacgttcgcggactgggcgccatgatcgccattgagttgttc
gaaaatggcgaccccagcaaaccgaacgcgacactgaccgccgatattgtggcccgcgct
cgcgataaagggttaattctgctgtcctgcggtccttactacaacatcctgcgcatcctc
gttccactcaccattgacgcctcgcagattcggcaaggtctggagattatcgcccagtgt
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system