KEGG   Salmonella enterica subsp. arizonae: SARI_01442Help
Entry
SARI_01442        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00040  Pentose and glucuronate interconversions
ses01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SARI_01442
Enzymes [BR:ses01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     SARI_01442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N Shikimate_DH NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABX21339
UniProt: A9MRN6
LinkDB All DBs
Position
1404233..1405252
Genome map
AA seq 339 aa AA seqDB search
MKSIVIEKPNTLTIETRALPQPAPGEVRVNVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGDDINSARIGERVAVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY
AVVPARNAHRIPDSVADHHAVMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQAL
KGVYQVNTVIVVDRIEERLAMAKQSGADWTLNNGQHSLAEFLQEKALKPTLIVDAACHPA
ILQEAITLASPAARIVLMGFSSDPCEFIQQGITGKELTIYSSRLNANKFPVVIDWLNKGL
IDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLSFAK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatcgtaatcgaaaaaccgaatacattaaccatcgaaacgcgcgcgctcccg
cagcctgcgccgggtgaagttcgcgttaacgtgaaactggcgggtatttgtggttccgac
agccatatttatcggggacataatcctttcgcaaaatatccccgcgtgattggccacgaa
tttttcggcgtcattgacgccgtaggcgacgatattaatagtgcgaggataggagaacgg
gtggcggtcgatccggtgatcagttgcgggcattgttacccttgctcagtgggtaaaccc
aatgtgtgtacttcgttggtggtgctgggcgtgcatcgtgacggcggcttcagcgagtat
gcggtggttccggcccgcaatgctcaccgtataccggatagcgttgcggaccatcatgct
gtcatggttgagccgtttaccattgcggcaaatgtaacgggacaggtgaatccaaccgag
caggacgtggcgcttatctatggcgcaggcccaatgggattgacgaccgtacaggcgctg
aagggggtctatcaggttaacaccgtgatagttgttgatcgcattgaagagcgtttagcg
atggcgaagcagagcggcgctgattggaccctcaataatggtcaacattcactggcggaa
tttctacaggagaaggcgctaaaaccgacattgattgtcgatgccgcctgtcatcccgct
atcctgcaagaggcgattacccttgcatcgcctgcggcacgcattgtcctgatgggattt
tccagcgacccgtgtgagtttatacagcagggtattaccggaaaagagctgactatttat
tcatcgcgtcttaatgccaataaattcccggtcgtgattgactggctgaataaagggctt
attgatccggataagctgataacccatacatttgattatcaacatgtcactgatgcgatt
gagcttttcgagaaagaccagcgtcaatgctgcaaagtcttactctcttttgcgaaataa

DBGET integrated database retrieval system