KEGG   Salmonella enterica subsp. arizonae: SARI_01531Help
Entry
SARI_01531        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SARI_01531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ses02000]
    SARI_01531
Enzymes [BR:ses01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SARI_01531
Transporters [BR:ses02000]
 Other Transporters
  Pores ion channels [TC:1]
   SARI_01531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_C_2 GST_N_3 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ABX21427
UniProt: A9MEH0
LinkDB All DBs
Position
1490236..1490841
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
IKPAVRAGLEKKFQYVDEALSDDQWICGQRFTIADAYLFTVLRWAYGVNLNMSGFTHIES
YMKRVAERPTVAAALKAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgctctcttgcttcccacataaccctgcgcgaa
attggcaaagactttacgctcgatggcgtcgatctcgcgaaaaagcgcctggaaaacggc
gatgattacctggcagtaaaccctaaaggacaggttccggctctgcttctggatgacggc
acgttgttgactgaaggcgtcgccattatgcagtacctcgccgatagcgttcccgatcgc
cagcttctggcgcctgtaagcagccttgcccgttaccatacgctggaatggctcaactat
attgcaacggaactgcataaaggctttaccccgctgttccgccctgacacaccggaaaca
attaaacctgccgttcgcgccggtctggaaaagaaatttcagtatgttgacgaggcgctt
tcagacgaccagtggatttgcggccagcgttttactatcgcggacgcttatctatttacc
gtattgcgttgggcatatggcgtaaacctgaatatgagcgggtttacgcatattgaaagt
tatatgaagcgtgtcgcggaaagaccgaccgttgcggcagcgcttaaggcggaaggactg
aagtaa

DBGET integrated database retrieval system