KEGG   Salmonella enterica subsp. arizonae: SARI_02327Help
Entry
SARI_02327        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ses  Salmonella enterica subsp. arizonae
Brite
KEGG Orthology (KO) [BR:ses00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SARI_02327
Enzymes [BR:ses01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SARI_02327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Glutaredoxin NAD_binding_8 Thi4 K_oxygenase AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: ABX22190
UniProt: A9ML20
LinkDB All DBs
Structure
PDB: 

Position
complement(2250008..2251573)
Genome map
AA seq 521 aa AA seqDB search
MLDMNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNSRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAASED
GLHKIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYLDRVSGDIHSVALAGIFVQIGLLPNTNWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatgaatatgaaaacccagctcaaggcttaccttgagaaactgacaaaacct
gttgagctgattgccacgctggatgacagcgcaaaatcggcggaaatcaaagaattgctg
gctgaaatcgccgagctgtcagataaggttacgtttaaagaagacaatactctgccggtt
cgcaagccgtcttttctgattacgaatccaggttctcagcaggggccgcgctttgcaggc
tctcctctgggccacgaatttacctcgttggttctggcgctgctgtggaccggtggtcat
ccgtcaaaagaagcgcagtcgctgctggaacagattcgtgatattgacggtgattttgaa
ttcgaaacgtattattccctctcctgccataactgtccggacgtggtgcaggcgctgaac
ttgatggcggtgctgaactcgcgtattaaacatacggcgattgacggaggtactttccag
aacgagatcaccgagcgtaatgtgatgggcgttcccgcggtctttgtcaacggtaaagag
tttggccagggacgtatgactctaactgagattgttgccaaagtggataccggcgcagaa
aaacgtgcggcggaagcgcttaacaaacgcgacgcgtatgatgtgctgattgtcggttcc
ggcccggcgggggcggcggcggcggtctattcggcgcgcaaaggtatccgtaccggtctg
atgggcgagcgcttcggcggtcaggtgctggatacggtggatatcgaaaattatatttcg
gtaccgaaaaccgaaggccagaaactggcgggcgcgcttaaagcgcatgtcagcgattac
gacgttgacgttatcgacagtcagagcgcaagtaaactggttccggctgcgtcagaagac
ggcctgcataagattgaaacggcgtccggcgcagtattgaaagcgcgcagtatcatcatc
gccaccggcgcgaaatggcgcaatatgaatgtgccgggcgaagatcagtatcgtaccaaa
ggcgtaacctattgtccgcactgtgacggtccgttgtttaaaggcaagcgcgttgcagtc
atcggcggcggcaactccggcgtcgaagcggccatcgatctggcgggtattgtggaacac
gttacgttgctggagttcgcgccggaaatgaaggcggatcaggtattacaggataaagtg
cgtagcctgaaaaacgtcgatatcattttgaatgcgcaaacgacagaagtgaagggtgac
ggttcgaaagtggtgggcctggagtatcttgaccgtgtaagcggtgatattcatagcgtc
gcgctggcggggatttttgtgcagattggtctgttgccgaataccaactggctggaaggc
gcgcttgagcgtaaccgcatgggcgagatcattattgacgcaaaatgtgaaaccagcgtt
aagggcgttttcgctgcaggcgactgtaccaccgttccttacaaacagattatcatcgcc
acaggcgaaggggcgaaagcttcgttgagcgcctttgattatctgattcgcaccaaaatc
gcataa

DBGET integrated database retrieval system