KEGG   Salmonella enterica subsp. arizonae: SARI_02546Help
Entry
SARI_02546        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00473  D-Alanine metabolism
ses00550  Peptidoglycan biosynthesis
ses01100  Metabolic pathways
ses01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SARI_02546
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SARI_02546
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SARI_02546
Enzymes [BR:ses01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SARI_02546
Peptidoglycan biosynthesis and degradation proteins [BR:ses01011]
 Precursor biosynthesis
  Amino acid ligase
   SARI_02546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ABX22404
UniProt: A9MMS9
LinkDB All DBs
Structure
PDB: 

Position
2468721..2469833
Genome map
AA seq 370 aa AA seqDB search
MEWVFKMAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDA
ENYLQNADDPAHIALRPSAISLAQVPGKHEQQLINAQNGQPLPTIDVIFPIVHGTLGEDG
SLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRANRHAFSFAEM
ESRLGLPLFVKPANQGSSVGVSKVANEAQYLQAVALAFEFDHKVVVEQGIKGREIECAVL
GNDSPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSGVNDKIRAIAIQAYQTLG
CAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALERH
AADNALKTTM
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggtttttaagatggcgaaattgcgggtaggaatagtatttggcggcaaatcg
gcggaacatgaagtgtctttgcaatcagcgaaaaatatcgttgatgcgatcgataaaacc
cgcttcgacgtcgtgctgttagggatagataaggcggggcaatggcatgttaacgatgcg
gaaaattatttgcagaatgcagacgatccggcacatatcgcgctacgtccttcggcaatc
agtctggcccaggtgcctggcaaacacgaacagcaattgattaacgcccagaacgggcag
ccgctaccgacgatagatgtaatttttcctatcgtccacggtacgctgggtgaagacggc
tcattgcaagggatgctgcgcgtcgcaaacttaccgtttgtcggttcagacgttttgagc
tctgcggcctgcatggataaagacgtcgccaaacgactgctgcgcgatgcaggactaaat
atcgccccgtttattactctcacccgagcgaaccgccacgcgtttagctttgccgagatg
gaatcccgcctgggactgccgctgtttgttaagcccgccaatcagggctcttcggtcggc
gtaagtaaagtcgctaacgaagcgcaatacctgcaggcggtcgcgctggcctttgaattc
gatcataaagtagtcgtggaacaagggatcaaagggcgcgagatcgaatgcgccgtatta
ggtaacgatagcccgcaggccagtacctgcggcgaaatcgtactgaatagcgaattttac
gcctacgataccaagtatattgatgataatggcgcacaagttgtcgtgcctgcgcagatc
ccttccggggtgaatgacaagatccgcgcaatcgcgattcaggcctatcagacgctgggt
tgcgcgggcatggctcgtgtcgatgtctttttaacgccagagaatgaggtagtgattaac
gagattaatacgctgccaggttttaccaatatcagtatgtatccaaaactctggcaggcg
agtggcctgggctataccgatttgatcagccgcctgattgagctggcgctggaacgccat
gcggcggataacgccttaaaaaccacgatgtaa

DBGET integrated database retrieval system