KEGG   Salmonella enterica subsp. arizonae: SARI_02879Help
Entry
SARI_02879        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00550  Peptidoglycan biosynthesis
ses01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SARI_02879
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SARI_02879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ses01011]
    SARI_02879
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ses03036]
    SARI_02879
Enzymes [BR:ses01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SARI_02879
Peptidoglycan biosynthesis and degradation proteins [BR:ses01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SARI_02879
Chromosome and associated proteins [BR:ses03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    SARI_02879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: ABX22726
UniProt: A9MQC8
LinkDB All DBs
Position
complement(2801735..2803489)
Genome map
AA seq 584 aa AA seqDB search
MTRINSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWLQIIAPDMLVRQGDMRSLRV
QEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALSTALNIPLDQL
SARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNV
DSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQALV
YRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDAMRNRTITDVFE
PGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSSNVGV
SKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMVT
PLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFPESTVRTVVHMMESVALPGGGGVKA
AIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGA
VSAPVFGAIMGGVLRTMNIEPDALATGEKNEFVINQGEGTGGRS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtataaattcgaaacgccaggaagaacagaccaacttcatcagttggcgtttt
gcgttgctttgcggctgtattttactggcgctggtttttttacttgggcgcgcggcgtgg
ctacagattatcgccccggatatgctggtgcgtcagggcgatatgcgttcattgcgtgtt
caggaagtctccacctcacgcggtatgattaccgaccgttccgggcgtccactggcggtc
agcgtaccggttaaggcgatctgggccgatccgaaagaagttcatgacgccggcggcatc
agcgtcggcgatcgctggaaagcgctttccaccgcgctcaatatcccgctcgatcagctc
tccgcccgtatcaacgccaacccgaaagggcgttttatttatctggcgcgtcaggtgaat
cctgacatggcggactacatcaaaaaactcaaactgccgggtattcatttgcgtgaagaa
tcacgccgctactacccgtcaggagaagtaaccgctcacctcatcggttttaccaacgtc
gatagtcagggaattgaaggcgttgaaaagagcttcgataagtggcttaccggtcagcct
ggcgagcgaatcgtgcgtaaagaccgctatggtcgcgtgatagaggatatctcctccact
gacagccaggctgcgcacaacctggcgttaagcattgatgaacgcttacaggcgctggtt
taccgcgagctgaacaacgcggtggcgtttaacaaggcggaatccggtagcgcggtgctg
gtcgatgtcaataccggtgaagtgctggcgatggccaacagcccttcttataaccccaac
aaccttgccggtacgccgaaagacgcgatgcgtaaccgcaccatcaccgacgtgtttgaa
ccgggttctacggttaagccgatggtggtgatgaccgcgcttcagcgcggtatcgtcaac
gaaaatacggtgttgaataccgttccataccgaattaacggccacgaaatcaaagacgtg
gcgcgctacagcgaattaaccctgaccggggttctacagaagtcgagtaacgtcggcgta
tccaaactggcgttagcgatgccgtcctcagcgttagtagatacttactcacgttttggg
ctaggaaaggcgaccaatttggggttggtcggagaacgcagtggcttatatcctcaaaaa
caacggtggtccgacatagagagggccaccttctctttcggctacgggctaatggtaacg
ccgttacagttagcgcgagtctatgcaacgatcggcagctatggcatttatcgcccgctg
tcgattaccaaagtcgatccgcctgtacccggcgaacgcatatttcctgaatccaccgtg
cgcaccgtggtgcatatgatggaaagcgtggcgctgcctggcggcggcggcgtgaaggcg
gcaattaaaggctaccgtatcgctatcaaaaccggtacggcgaaaaaagtggggccggac
ggtcgctacatcaacaaatatattgcttataccgcaggcgtagcgcctgcgagtcagccg
cgcttcgcgctggtagttgtaatcaacgatccgcaggcgggtaaatactacggcggcgcc
gtttccgcgccggtgtttggtgccatcatgggcggcgttctgcgcaccatgaacatcgaa
ccggatgcgctggcaacgggcgaaaaaaatgaatttgtaattaatcaaggcgagggaaca
ggtggcagatcgtaa

DBGET integrated database retrieval system