KEGG   Salmonella enterica subsp. arizonae: SARI_03142
Entry
SARI_03142        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
Organism
ses  Salmonella enterica subsp. arizonae
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ABX22982
UniProt: A9MER6
LinkDB
Position
3059588..3060268
AA seq 226 aa
MSPLSSPLPGIAEAGGDTNPRAVGQHSKIRFKNADAIGFPAGDVLANFFAQFGYVCAPSS
QPFLPYFLSTLDALAWRSGVPEMFYPEALTPGLREVSKDGDMWGNIYPRAGALSQTHDYK
AGAVIAQRAADLVTRSGQSHVYIPLAATSHDGYWPPDLVTEGDSNNHQWQMLVPKKSASC
AIFPDGSSTDSYADKLAEDGAYVWTLWRPYKCCPRRGQTFLGSSGG
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtcgccgttaagctcgccgctgcccggtatcgccgaagccgggggcgatactaatccc
cgcgctgtcggccagcacagcaaaatccgatttaaaaacgctgatgcaataggtttccct
gcaggtgacgtactggcaaatttcttcgcccagtttggctacgtctgcgctccgtcgtca
cagccttttctcccctacttcctcagcaccctggatgcgctcgcctggcgcagcggtgta
ccggaaatgttttacccggaggcgctaacgccgggactgcgtgaggtgagtaaagacggc
gatatgtggggaaatatctacccgcgagccggagcgctcagccagacgcatgactataag
gccggagcggtcatcgcccagcgcgctgccgatctggtaacgcgaagtggtcagtcacat
gtttatattccgctggctgccacttcacacgacggatactggcctccggatctggtcacg
gaaggcgacagcaataaccaccagtggcaaatgctggttccaaaaaaatccgcctcctgc
gccatcttcccagatggatcctccacagactcctacgccgataaactggcggaagatggc
gcgtatgtctggacgctgtggcggccctacaaatgctgtccgcgtcgtgggcagaccttt
cttggcagcagcggaggttaa

DBGET integrated database retrieval system