KEGG   Salmonella enterica subsp. arizonae: SARI_04625Help
Entry
SARI_04625        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ses  Salmonella enterica subsp. arizonae
Brite
Enzymes [BR:ses01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SARI_04625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABX24396
UniProt: A9MRJ8
LinkDB All DBs
Position
4526267..4526797
Genome map
AA seq 176 aa AA seqDB search
MKKSISTFIFAGFFVAGVASAASMKIPMNEVLPSGSGKALGEITVTETPYGLLFQPHLSG
LAPGIHGFHVHTNPSCLPELENGKEVPALKAGGHLDPGKTGKHMGPYNDKGHLGDLPGLV
VNADGTATYELLAPRLKSLSELKGHSLMIHAGGDNYSDTPAKLGGGGARFACGVVE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagcatcagcacatttatattcgccggtttttttgtggctggagtcgcgtcg
gctgcttcaatgaagattccgatgaatgaagtgttgccttctggaagcggaaaggcgctc
ggggagattaccgtaacagaaacaccttatggtttactgtttcagccacatctgtctggc
cttgctcccgggatacatggtttccatgtgcatactaacccaagctgtttgccggagctt
gaaaatggtaaagaagtccctgcgttgaaggcgggcgggcatctcgatccgggaaaaaca
ggcaagcacatggggccttataatgataaaggacacctgggcgatttacctggactggtg
gtaaatgcagatggaaccgcgacctacgaactgttggctccccgcctgaaatctctgtcg
gaactgaagggacactctctgatgatccatgctggcggggataattactctgacactccg
gctaaactgggtggcggtggggcacgttttgcctgtggtgtagtggaataa

DBGET integrated database retrieval system