KEGG   Saccharothrix espanaensis: BN6_11270Help
Entry
BN6_11270         CDS       T02404                                 

Definition
(GenBank) Neuraminidase like protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00511  Other glycan degradation
sesp00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BN6_11270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN6_11270
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BN6_11270
Bacterial toxins [BR:sesp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BN6_11270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 Laminin_G_2 Laminin_G_1 BNR_3 BNR DUF4185 LpqV
Motif
Other DBs
NCBI-ProteinID: CCH28453
UniProt: K0JW90
LinkDB All DBs
Position
complement(1185789..1188773)
Genome map
AA seq 994 aa AA seqDB search
MRLLVTVLALLLAGSSVAAASGVAPSTSSIGVEHVLFKSGTGGYGCYRIPALVRTASGAL
LAFAEGRRSPSCADRGDIDLVVRRSTNDGRTWSPTRVVLRGFGDNPFAPYTRGNPAPVVD
AQTGRVFLLSTSNPAVPGGERLPWVQHSDDDGLTWSTSRQIPASFAGSTRGWFATGPSHG
VQLRNGNLVVGAHQGVDGHVYAGVLYSTDHGDTWHASTTPDSLVEGKLNPGEMSVAELPN
GDVYVAGRNHIATGHHRTRAISKDGGASVSASTAIPTLTTPDVQGSVLALRSGTLLFAGP
SDPQDRKLMRIRHSTDNGVTWTAGGLVNGSRAGYSDLAELTTGEIGLLYEGGEKFSADEI
RFTRFTTQQAQVPGGTNPAGPATPAPGPTSPDVSPEANDAYVRGSVGGGLVGQADLPWTR
SLDVGADDFTVSFSFKHNGSTADQALFWAYGQGGSVPQVWLRVAKSGQVVAWVQGSGGGA
TTSVPGAFADGAWHQLTLTRQAGQVTLAVDAASTSATGVAGVVGQVGGRTGIRLGARLDG
ADPFTGTLKDFTLTRAGRVVADLPLVTVDGAATATRTTVAITDDLTGHCADGTLLGGHRV
PVAGKFGSALDVDSTHPGAEVPYLAALDPGGRDFTYSLWFQHKGGADQALLWAYGATAGK
PSVWVRAQPGSDRLYGWVQTDVGQVAVQVKDGTDAAAFGDGKWHQLVLRRVGDRVELSVD
GGAPAVATGLTGSVGGPLGVRVGSKPDGSDVLDGVLDDVKLDIAGVPVLRWGFDGQNTQA
HDVVRVPAGPGTPDGSQRCNHAAVRGGAATTAGAVGRGLAFDGVDDSVVVPYEPVDGADF
AVSTSFKYSGGGDQVLVWAYGVGATERALWLRAQPSKDRLLAWVQTDAGAFGVAAEDPSA
VAAFGDGKWHRAELRRTGDRLELSVDGVVSGRAEIRGSLNYSDGFAVDGFQLGARPDGAD
RFKGALDEFRVERGGATLVHLPFEVVSGREYVRG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgagactcctcgtcaccgtcctggccctcctgctcgccggctcctccgtggccgccgcg
agcggggtggcgccctccacgtccagcatcggtgtggagcacgtgctgttcaaatccggg
accggcggttacggctgctaccggatccccgcgctggtccgcaccgcgagcggcgcgctg
ctggcgttcgccgagggccggcggtcgccgtcgtgcgccgaccgcggcgacatcgacctg
gtcgtgcgccgatccaccaacgacggccgcacctggagcccgacgcgcgtcgtgctgcgc
ggcttcggcgacaacccgttcgccccgtacacgcgcggcaacccggcccccgtggtcgac
gcgcagaccggccgggtgttcctgctgtcgacctcgaacccggccgtgccgggcggcgag
cggctcccgtgggtgcagcacagcgacgacgacggcctgacctggtcgacgtcccggcag
atcccggcgtcgttcgccggttccacccggggctggttcgccaccggaccgtcgcacggc
gtgcagctgcgcaacggcaacctcgtcgtcggcgcgcaccagggcgtcgacgggcacgtc
tacgccggcgtcctctacagcaccgaccacggcgacacctggcacgcgagcaccaccccg
gactcgctggtcgagggcaagctcaaccccggcgagatgtcggtggccgaactgcccaac
ggcgacgtctacgtggccggccgcaaccacatcgccaccggccaccaccggacccgcgcg
atcagcaaggacggcggcgcgtcggtctccgcgtcgaccgccatccccacgctgaccacg
ccggacgtgcagggcagcgttctggcgctgcgcagcggaaccctgctgttcgctggcccg
tccgacccgcaggaccgcaagctgatgcgaatccggcactcgaccgacaacggcgtcacg
tggaccgccggcgggctggtcaacggcagccgcgcgggctactcggacctcgcggaactc
accacgggcgagatcggcctgctgtacgagggcggcgagaagttctccgccgacgagatc
cgcttcacccgcttcaccacccagcaggcacaggtccccggcggcaccaaccccgccggc
ccggcgaccccggcacccggcccgacctcgccggacgtctcaccggaggccaacgacgcc
tacgtgcgcggctcggtgggcggtggtctggtcgggcaggcggacctgccgtggacgcga
tcgctggacgtcggcgcggacgacttcacggtcagcttctcgttcaagcacaacggttcc
accgccgaccaggcgctgttctgggcctacggccaaggcggctcggtgccgcaggtctgg
ctgcgggtggccaagtcgggccaggtagtggcctgggtgcagggcagcggcggcggcgcg
accacgtcggtgccgggcgcgttcgccgacggcgcgtggcaccagctcaccctgacccgg
caggccgggcaggtgaccctggcggtggacgcggcctcgacctcggcgaccggcgtcgcc
ggagtggtcggccaggtcggcggccgcaccgggatccggctgggcgcgcgcctggacggg
gcggacccgttcaccgggacgctgaaggacttcacgctgaccagggccggccgggtggtc
gccgacctgccgctggtcacggtcgacggcgcggcgacggccacccggacgacggtggcg
atcaccgacgacctgaccgggcactgcgcggacggcaccctgctgggcggccaccgggta
ccggtcgccgggaagttcggctcggcgttggacgtcgacagcacgcaccccggcgccgag
gtgccgtacctggccgcgctggaccccggggggcgggacttcacgtactcgctgtggttc
cagcacaagggcggcgcggaccaggcgctgctgtgggcgtacggcgcgacggccggcaag
ccgtcggtgtgggtccgcgcgcagcccggctcggaccggctgtacggctgggtgcagacc
gacgtgggccaggtcgccgtgcaggtgaaggacggcacggacgcggcggcgttcggcgac
ggcaagtggcaccagctggtgctacgccgcgtcggcgatcgggtggagctgtcggtggac
ggcggagcgccggccgtggcgacggggttgacggggtcggtcggcgggccgttgggcgtg
cgggtcgggtcgaagccggacgggtcggacgtgctggacggggtgctggacgacgtgaag
ctggacatcgcgggtgttccggtgctgcggtggggcttcgacggccagaacacccaggcg
cacgacgtcgtgcgggtgcccgccggccccgggacgccggacggttcacagcggtgcaac
cacgcggcggtgcgcggtggcgcggcgaccacggcgggtgcggtcggacgcgggttggcg
ttcgacggggtggacgattcggtggtcgtgccgtacgagccggtggacggcgcggatttc
gcggtgtcgacgtcgttcaagtacagcggcggtggggaccaggtgttggtgtgggcgtac
ggggtcggcgcgacggaacgggcgttgtggttgcgcgcgcagccgtcgaaggaccggttg
ttggcgtgggtgcagaccgacgccggcgcttttggcgtggcggcggaggacccgtcggcg
gtggccgcgttcggtgacggcaagtggcaccgggccgaattgcgccggaccggggaccgg
ctggaattgtcggtggacggagtggtgtcgggacgtgcggagatccggggctcgctgaat
tacagcgacggattcgccgtggacggtttccagctgggcgcgcgcccggacggcgcggac
cggttcaagggcgcactggacgagttccgggtcgaacggggtggagcgacgctggtgcac
ctgccgttcgaggtggtgtcggggagggagtacgtcagaggctga

DBGET integrated database retrieval system