KEGG   Saccharothrix espanaensis: BN6_21360
Entry
BN6_21360         CDS       T02404                                 

Gene name
griI1
Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00997  Biosynthesis of various secondary metabolites - part 3
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BN6_21360 (griI1)
Enzymes [BR:sesp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     BN6_21360 (griI1)
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: CCH29458
UniProt: K0JYX4
LinkDB
Position
complement(2233554..2234372)
AA seq 272 aa
MSARPGGTAVRLARLARHREGRYLFVPLDHSVADGPIIAAGRFNWLVRVAVEGGADAVVV
HKGRVATLDPALLRACSLIVHLSASTAHGPDPDAKVLVGDVEEAIQLGADAVSVQVNIGS
ATESRQLADLGAVADACRRWNVPLLAMVYPRGPAITDPHDPTLLSHVVNIAADLGASLVK
TTWPVPLERMAEVVESCPIPVLSAGGPGNRGVDPAAFAATLLAHGCSGLAIGRGIFQSSS
PASVIRAVSAVVHEEALSPVPVLDRVHSVPAR
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtccgccaggccgggaggaaccgcagtccgtctcgcaaggctggccagacaccgcgag
ggccgctacctgttcgtgccgctggaccactcggtcgccgacggaccgatcatcgcggcc
gggcgcttcaactggctcgtccgcgtggcggtcgagggcggcgcggacgccgtcgtggtc
cacaaaggacgggtcgcgacgctcgaccctgccctgctgcgcgcgtgctcgttgatcgtg
cacctgagcgccagcaccgcgcacggcccggaccccgacgccaaggtgctggtcggcgac
gtggaggaggcgatccagttgggcgcggacgcggtgagcgtccaggtcaacatcggctcc
gccacggagagccggcagctggccgacctcggcgcggtggccgacgcgtgccgccggtgg
aacgtgccgctgctggcgatggtgtacccgcgcggcccggcgatcaccgacccgcacgac
ccgacgctgctgtcgcacgtggtcaacatcgcggcggacctgggcgcgtcgctggtgaag
accacctggccggtgccgctggagcggatggcggaggtggtggagagctgcccgatcccg
gtgctctcggcgggcggtccgggcaaccggggcgtcgacccggcggcgttcgccgcgacg
ctgctggcgcacgggtgcagcgggctggcgatcggccggggcatcttccagagcagttcg
cccgcgagcgtgatccgcgccgtctcggccgtggtgcacgaggaagccctgtcccccgtg
cccgtgctcgaccgcgtccactcggtcccggcccgctga

DBGET integrated database retrieval system