KEGG   Saccharothrix espanaensis: BN6_24580Help
Entry
BN6_24580         CDS       T02404                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain-containing protein
Organism
sesp  Saccharothrix espanaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CCH29772
UniProt: K0JWB5
LinkDB All DBs
Position
complement(2598503..2599669)
Genome map
AA seq 388 aa AA seqDB search
MTGLLPWSLGPTLKPIADNCRPRFGARVKNPFSAYAPPVDLPVMPPVRPMLAKAVREVPR
EPGLVYEPKWDGFRCVVFRDGDELELGSRNDRPLTRYFPEVADLLANGLPARCVVDGEVV
IVTPDGLSFDLLQLRLHPAASRVRKLAAETPASFVAFDLLALGDRDLTGVPFGERRALLA
EALTETPGLYLTPATDDPDVAQDWFTRFEGAGFDGVVAKRTDLPYEQDRRVMWKVKHERT
ADCVVAGYRTHKDGEGVGSLVLGLYDDEGTLHHVGVASSFTATRRRELVAELEPYRARAL
DDHPWGEWARLDAATPGAQSRWAPDKTLSWEPLRPELVAEVRYEHVQGTRFRHTARLVRF
RPDRTPDSCTYRQLEEVPPAELTEMFRP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactggccttcttccgtggtcgttggggccaactctaaaacccattgcggacaactgt
cgccctcgattcggcgcgcgggtgaaaaacccgttctcggcttacgctcccccggtggac
ctgcccgtgatgccgcccgtgcgcccgatgctggccaaggccgtgcgcgaggtgccccgc
gagcccggactggtctacgaaccgaagtgggacggcttccggtgcgtggtgttccgcgac
ggcgacgagctggagctcggctcccgcaacgaccgcccgctcacccggtacttccccgag
gtcgccgacctgctcgcgaacgggctgccggcgcggtgcgtggtggacggcgaggtcgtc
atcgtcaccccggacgggctgagcttcgacctgctccaactgcgcctgcacccggccgcg
tcccgggtgcgcaagctggccgccgagacgcccgcgtcgttcgtggcgttcgacctgctc
gcgctcggcgaccgcgacctgaccggtgtgccgttcggggagcgccgcgcgttgctggcc
gaagccctgaccgagacgcccggcctctacctgacgccggcgaccgacgacccggacgtc
gcgcaggactggttcacccggttcgagggcgcggggttcgacggcgtggtcgccaagcgc
accgacctgccctacgagcaggaccgccgggtgatgtggaaggtcaagcacgaacgcacc
gccgactgcgtggtggcgggctaccggacgcacaaggacggcgagggcgtcggctcgctg
gtgctgggcctgtacgacgacgagggcaccctgcaccacgtgggcgtggccagcagtttc
accgccacgcgacgacgggagttggtggccgagctggagccgtaccgggcccgcgcgctg
gacgaccacccgtggggcgagtgggcccggctcgacgccgccacccccggcgcgcagagc
cgttgggccccggacaagacgctgtcgtgggagccgctgcggccggaactggtggccgag
gtgcgctacgagcacgtccagggcacgcggttccggcacaccgcccggctggtccgcttc
cgccccgaccggacgccggactcgtgcacctaccggcagctcgaagaggtgccgccggcc
gagctgaccgagatgttccgaccatga

DBGET integrated database retrieval system