KEGG   Saccharothrix espanaensis: BN6_38550Help
Entry
BN6_38550         CDS       T02404                                 

Definition
(GenBank) hypothetical protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
sesp  Saccharothrix espanaensis
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN6_38550
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN6_38550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CCH31146
UniProt: K0JYF0
LinkDB All DBs
Position
4210654..4211163
Genome map
AA seq 169 aa AA seqDB search
MVIERVTGRSWRDEVTRRVLRPLGLRDTGTPVDRPHLPGPHASAYEELDGSPFDVTRFNP
SVGGAAGSMTSTTADLERFARKLFTGGLLKPAERAELTRTTAVSTYYGLGAVVLPLSCGT
TVLGHDGYLLGWLTEMWVDQDGSRSLTLSANMARGGLLSVGPLLDEVFC
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgagcgcgtcacgggccggtcgtggcgggacgaggtgacgcggcgcgtgctg
cgccccctggggctgcgcgacacgggcacgcccgtcgaccggccacacctgcccggaccg
cacgcctccgcgtacgaggaactggacggcagcccgttcgacgtgacccggttcaacccc
tccgtcgggggcgcggcgggctcgatgacgtccacgaccgccgacctggagcggttcgcg
cgcaagctgttcaccggtggcctgctcaagcccgccgagcgggccgaactgacccggacc
accgcggtgagcacgtactacggcctgggcgcggtggtgctcccgctcagctgcggcacg
accgtgctggggcacgatggttacctcctgggctggttgaccgagatgtgggtcgaccag
gacggttcgaggagtctcaccctgtccgcgaacatggcgaggggcggcttgctgtccgtg
ggaccgctgctcgacgaggtgttctgctga

DBGET integrated database retrieval system