KEGG   Saccharothrix espanaensis: BN6_42910Help
Entry
BN6_42910         CDS       T02404                                 

Definition
(GenBank) putative DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BN6_42910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sesp03400]
    BN6_42910
Enzymes [BR:sesp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BN6_42910
DNA repair and recombination proteins [BR:sesp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BN6_42910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CCH31574
UniProt: K0K408
LinkDB All DBs
Position
4694814..4696292
Genome map
AA seq 492 aa AA seqDB search
MSGDLSEYRSKRVVGRTPEPLPAVEALLPRGSDDTFVIQEHHASSLHWDVRLERGGVLVS
WAVPKGLPAEPGTIRLAVRTEDHPVEYASFEGVIPKGEYGAGRMFVWDRGRYETVKWSDR
EVDVVLHGSRIEGEFVFFRRGSSGGGGSGRDWMVRRRHEAVRPDWVALPEWVEPMLATAA
SGLPARPEEFAFEFKWDGVRAVARVEGGRLRLVSRSGVDITAVYPELQGLGGALGSTQVL
LDGEVVAFAGGRPSFGALQQRLQASAAQARRLAARVPVTFLVFDVLHLDGASTVGLPYAR
RRELLEGLGLVGPHWLVPRAFPGAGAEVLAASREQGLEGVVAKRLDSRYVPGVRSAWWLK
ITDVAAQEVVIGGWRPGGGRRAGLVGSLLLGVPDGAGLVFVGSVGTGFGEAELPGLTERL
RGLEVSRSPFSSEVPRERARGARWVRPVLVGEVVHRQWTAEGRMRFPTWRGLRPDRVPEE
VRRGGGDGGAGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggacctgtcggagtaccggagcaagcgggttgtggggcggacgccggagccg
ttgccggcggtggaggcgctgctcccccgtggttctgatgacacgttcgtgatccaggag
caccacgcgtcgagcctgcactgggatgtgcggttggagcggggtggggtgttggtgtcg
tgggcggtgccgaaggggttgccggcggagccggggacgatccggttggcggtgcgcacg
gaggaccacccggtggagtacgcgtcgttcgagggggtgatcccgaagggcgagtacggg
gcggggcggatgttcgtgtgggaccggggtcggtacgagacggtgaagtggagtgaccgc
gaggtcgacgtggtgttgcacgggtcgcggatcgagggtgagttcgtgttcttccggcgg
gggtcgtcggggggcgggggttcgggccgggactggatggtgcggcggcggcacgaggcg
gtgcggccggactgggtggcgttgccggagtgggtggagccgatgttggcgacggcggcg
tcggggttgccggcgcggccggaggagttcgcgttcgagttcaagtgggacggggtgcgg
gcggtcgcgcgggtggagggtggccggttgcggttggtgtcgcggtcgggtgtggacatc
acggcggtgtacccggagttgcaggggttgggtggggcgttggggtcgacgcaggtgttg
ttggacggtgaggtggtggcgttcgcgggtgggcggccgagtttcggggcgttgcagcag
cggttgcaggcgagcgcggcgcaggcgcggcggttggcggcgcgggtgccggtgacgttc
ctggtgttcgacgtgctgcacctggacggggcgtcgacggtggggttgccgtacgcgcgg
cggcgggagttgttggaggggttggggttggtggggccgcactggctggtgccgcgggct
tttccgggtgcgggggcggaggtgttggcggcgagtcgggagcagggcctggagggggtg
gtggccaagcggctggattcgcgttatgtgccgggtgtgcggtcggcgtggtggttgaag
atcacggacgtggcggcgcaggaggtggtgatcggcgggtggcggccgggtgggggcagg
cgggcggggttggtggggtcgttgttgttgggggtgccggacggggcgggtctggtgttc
gtggggtcggtggggacggggttcggcgaggcggagttgccggggttgaccgagcggttg
cgggggttggaggtgtcgcggtcgccgttctcgtcggaggtgccgcgggagcgggcgcgg
ggtgcgcggtgggtgcgtccggtgttggtgggtgaggtggtgcaccggcagtggacggcg
gaggggcggatgcggtttccgacgtggcgggggttgcggccggatcgggtgccggaggag
gtgcggcggggtggcggggacggtggtgcgggtcggtga

DBGET integrated database retrieval system