KEGG   Saccharothrix espanaensis: BN6_57090Help
Entry
BN6_57090         CDS       T02404                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00473  D-Alanine metabolism
sesp00550  Peptidoglycan biosynthesis
sesp01100  Metabolic pathways
sesp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN6_57090
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN6_57090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN6_57090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sesp01011]
    BN6_57090
Enzymes [BR:sesp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN6_57090
Peptidoglycan biosynthesis and degradation proteins [BR:sesp01011]
 Precursor biosynthesis
  Amino acid ligase
   BN6_57090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CCH32967
UniProt: K0K5W2
LinkDB All DBs
Position
6388404..6389462
Genome map
AA seq 352 aa AA seqDB search
MPRPLVLLIGGRSTEHDASLHSYRHVLAEVGAEPERHEVVAVVYIRRLGGAQVFRRAPWP
VDEADLLAGPEIPTIDAVRFLAECGAFVFSLLHGTEGEDGCWQGVAEMFGLRGSFGPVLG
SALGMDKSLQSAVAASVIPDLRCPPVTVVRRDDIASGVDRALAELGDRAVVVKPNRMGAS
LLIEKLTDWDGADLLKAVSAIHEYDPEALVQEFVHGDEHSCGVVEQHGEPVALPVLRIQT
EHGFFGHAEKHRHGLAGVRVETSAVARRVQRVSELLFRELKLFGWSRFDFIVSGGELHFL
ETNTIPGLMSGSLFPAMLRAGGRSIGDLIDACVDAAHGRPAVSKHLAYRIEH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtccactcgtactgctgatcggcggcaggagcaccgagcatgacgcgtccctg
cacagttaccgacacgtcttggcggaagtcggcgcggaaccggagaggcacgaggtcgtc
gccgtggtctacatccggcgcctcggcggtgcccaggtcttccgccgcgcgccgtggccc
gtggacgaggccgacctgctggcgggccccgagatcccgaccatcgacgcggtccgcttc
ctggcggagtgcggtgccttcgtcttctccctgctgcacggcaccgagggcgaggacggc
tgctggcagggcgtcgccgagatgttcggactccggggcagcttcggtcccgtgctcggt
tcggccctcggcatggacaagtcgctccagtctgccgtcgcggcgtccgtgatccccgat
ctgcgctgccctcccgtcacggttgttcggcgggacgacatcgcgtcgggagtcgaccgg
gcacttgcagagttgggcgaccgtgccgtcgtggtcaagccgaaccggatgggcgcctcc
ctgctgatcgagaagctgaccgactgggacggagcggacctgctgaaggccgtgtcggcg
atccatgagtacgaccccgaggccttggtccaagagttcgtgcacggtgacgagcacagc
tgcggcgtggtcgagcagcacggggagccggtggcgctgccggtcctgcgcatccagacc
gagcacggcttcttcgggcacgccgagaagcacagacacggcctcgccggcgtgcgggtc
gagacctccgcggtggcgcgtcgcgtccaacgggtgtccgagctgctgttccgcgagctg
aagctgttcggttggagccgcttcgacttcatcgtctccggtggagagcttcacttcctg
gagacgaacacgatccccggcctgatgagcggcagcctcttccccgccatgttgcgcgct
ggcggccggtccatcggcgacctgatcgacgcctgcgtcgacgccgctcacggccgaccg
gccgtgagcaagcaccttgcctaccgcatcgagcactga

DBGET integrated database retrieval system