KEGG   Saccharothrix espanaensis: BN6_63900
Entry
BN6_63900         CDS       T02404                                 

Gene name
griI2
Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00997  Biosynthesis of various secondary metabolites - part 3
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BN6_63900 (griI2)
Enzymes [BR:sesp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     BN6_63900 (griI2)
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: CCH33633
UniProt: K0KAK8
LinkDB
Position
complement(7121900..7122691)
AA seq 263 aa
MRKALRLRRLSRPRDDKYLFVPLDHSVSDGPVVPRDRWHDLIRSVVVGGADAIIVHKGRV
RTLDPQVLGGCALVVHLSAGTSHAADANAKVLVGEVEEALRLGADAVSVHVNIGSDTEER
QLVDFGVVANACDSWNVPLVAMVYPRGPRIADPSDPALLAHVVNIAVDLGADLVKTNLAL
PVERMAEVVASCPIPVLVAGGPATGGSLVDHARASMATGCAGLAVGRRVFTSPAPMTLVA
ELASVIHADHPAELVHAMTGAVS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaggaaagcgttgcggctgcgacggctttcccggccgcgcgacgacaagtacctcttc
gtcccgctggaccacagcgtctccgacggtccggtcgtgccgcgtgaccggtggcacgac
ctgatcaggtcggtcgtcgtcggcggggcggacgccatcatcgtccacaaaggacgggtg
cgcaccctggacccgcaggtgctgggcggctgcgcgctggtcgtgcacctgagcgcgggc
acctcgcacgcggccgacgccaacgccaaggtgctcgtcggcgaggtggaggaggcgttg
cggctgggcgcggacgcggtcagcgtgcacgtcaacatcggctccgacaccgaggagcgc
cagctggtcgacttcggcgtggtcgcgaacgcgtgcgactcgtggaacgtgccgctggtc
gcgatggtctacccgcgcggaccgcgcatcgcggaccccagtgacccggcgctgctcgcg
cacgtggtcaacatcgccgtcgacctcggtgccgacctggtcaagaccaacctggcgctg
cccgtggagcggatggccgaggtcgtggcgagctgcccgatcccggtgctcgtcgcgggc
ggcccggcgaccgggggcagcctggtcgaccacgcccgcgcctcgatggcgacgggctgc
gcgggcctggccgtcggccgccgcgtgttcacctccccggccccgatgacgctggtcgcg
gaactcgcgtcggtgatccacgccgaccaccccgccgagctcgtgcacgccatgacgggc
gcggtttcctga

DBGET integrated database retrieval system