KEGG   Saccharothrix espanaensis: BN6_72610Help
Entry
BN6_72610         CDS       T02404                                 

Gene name
gtuS4-14
Definition
(GenBank) Glycosyltransferase, family 4
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00500  Starch and sucrose metabolism
sesp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_72610 (gtuS4-14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sesp01003]
    BN6_72610 (gtuS4-14)
Enzymes [BR:sesp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     BN6_72610 (gtuS4-14)
Glycosyltransferases [BR:sesp01003]
 Polysaccharide
  Storage polysaccharide
   BN6_72610 (gtuS4-14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CCH34493
UniProt: K0KD61
LinkDB All DBs
Position
8028850..8030097
Genome map
AA seq 415 aa AA seqDB search
MRVLMLSWEYPPVVVGGLGRHVHAVATELARQGHDVVVLCRQPTGSDAVTHPTSDSPVEG
VRLVRVAEDPAHLVFERDLVAWTLAMGHAMTRAGLALLRGWRPEVVHAHDWLVTHAAIAL
AEAAGVPLVATVHATEAGRHSGWLSQTLNQQVHSVEWWLANRADSLITCSAAMRTEVAHL
FEVDPAGITVLHNGIEPRRWRVRPAGVAAAREEFAADGPLLLFFGRLEWEKGVQDLIAAL
PRIRRAHRGTRVVVAGGGTHRDWLVEQARKHRVLRSVRFVGHLPDRTLAAVLAAADAVVL
PSRYEPFGIVALEAAAAGTPLVASTAGGLGEVVLDGVTGLSFAPGDVDGLARAVRSVLAD
RPAAVRRAKAAKARLGTDFDWARIAADTAGVYRAAAAREHGPLGRPKIATGNAFL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgatgttgtcgtgggagtacccgccggtcgtagtgggcgggctgggtcgg
cacgtgcacgccgtggcgaccgaactggcccggcaggggcacgacgtcgtcgtgctgtgc
cgtcagcccaccgggtccgacgccgtcacgcacccgacgtcggactcgccggtggagggc
gtccggctggtccgggtcgccgaggacccggcgcacctggtgttcgagcgcgacctggtg
gcgtggacgctggccatgggccacgcgatgacccgcgcgggcctggcgctgctgcgcggg
tggcggccggaggtcgtgcacgcgcacgactggctggtcacccacgccgcgatagccctc
gccgaggccgccggcgtgccgctggtggccaccgtgcacgccaccgaggccggccggcac
agcgggtggctgtcccagacgctcaaccagcaggtgcactcggtggagtggtggctggcc
aaccgggccgactcgctgatcacctgctccgcggcgatgcggaccgaggtggcccacctg
ttcgaggtcgacccggccgggatcaccgtgctgcacaacgggatcgagccccggcggtgg
cgggtgcggccggccggggtggcggcggcgcgcgaagagttcgccgccgacggcccgctg
ctgctgttcttcgggcggctggagtgggagaagggcgtccaggacctgatcgcggcgctg
ccccggatccgccgggcgcaccggggcacccgggtggtggtggcgggcggcggcacgcac
cgcgactggctggtggagcaggcccgcaagcaccgggtgctgcggtcggtgcggttcgtc
gggcacctgccggaccgcacgctcgcggccgtgctggcggcggccgacgccgtcgtgctg
cccagccggtacgagccgttcgggatcgtggcgctggaggcggcggccgccgggacgccg
ctggtcgcgtccaccgcgggcgggttgggcgaggtcgtgctggacggcgtgaccgggctg
tcgttcgcgccgggtgacgtggacgggctggcgcgggccgtgcgctcggtgctggccgac
cggcccgccgccgtgcgccgggcgaaggccgcgaaagcccggctgggcaccgatttcgac
tgggcccggatcgccgcggacaccgccggcgtctaccgggcggcggccgcccgggagcac
gggccgctcggccggcccaagatcgccaccggcaacgccttcctgtga

DBGET integrated database retrieval system