KEGG   Saccharothrix espanaensis: BN6_72780Help
Entry
BN6_72780         CDS       T02404                                 

Gene name
treS
Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00500  Starch and sucrose metabolism
sesp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_72780 (treS)
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BN6_72780 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BN6_72780 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CCH34510
UniProt: K0K2N5
LinkDB All DBs
Position
8050714..8052525
Genome map
AA seq 603 aa AA seqDB search
MAEQPRPDAALTGLDGVPHTGEAIGADGLLVEPQAEDFRSAKLAPREPDWFKGAVFYEVL
VRAFTDSNGDGTGDLRGLASRLDYLEWLGVDCLWLPPFYASPLRDGGYDISDFRAVLPEF
GSVEDFVYLLDEAHRRGIRVITDLVLNHTSDAHPWFQQSRAEPDGPYGDYYVWGDDDQRY
PDARIIFVDTESSNWTYDPVRGQFYWHRFFAHQPDLNFENPDVQEAMLDTLRFWLDLGID
GFRLDAVPYLFEQEGTNCENLPRTHDFLKRCRKVVDDEYPGRVLLAEANQWPSDVVEYFG
DPEVGGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPQIPDGCQWGIFLRNHDELT
LEMVSDEERDYMYAEYAKDPRMKANIGIRRRLAPLLENDRNQQELFTAMLLSLPGSPVLY
YGDEIGMGDNIWLGDRDAVRTPMQWTPDRNAGFSSCDPGRIYLPVIMDPVYGYQGLNVEA
QLNNQSSLLNWTRRMIEVRKQHHAFAEGDFTDLGGSNPSVLAYRRRWRRPDGHEDIVLCV
NNLSRFPQPVELDLSEHRGARPVELTGGVRFPTVGDLSYLLTLPGHGFYWFQLVEAGDEG
ETR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaccccgacccgacgccgcgctgaccggactggacggcgtgccgcacacc
ggtgaggccatcggcgcggacggcctgctggtcgaaccgcaggccgaggacttccggtcg
gccaagctcgcgccgcgcgagccggactggttcaagggggcggtgttctacgaggtgctg
gtgcgcgccttcaccgactccaacggtgacggcaccggcgacctgcgggggctcgcgtcc
cggctggactacctggagtggctcggcgtcgactgcctctggctgccgccgttctacgcc
tcgccgctgcgcgacggcgggtacgacatctccgacttccgggccgtgctgcccgagttc
gggtcggtggaggacttcgtctacctgctcgacgaggcgcaccggcgcggcatccgggtg
atcaccgacctggtgctcaaccacaccagcgacgcgcacccgtggttccagcagtcgcgg
gccgagccggacgggccctacggcgactactacgtctggggcgacgacgaccagcgctac
ccggacgcccggatcatcttcgtcgacaccgagtcctcgaactggacctacgacccggtg
cgcggccagttctactggcaccggttcttcgcccaccagccggacctcaacttcgagaac
ccggacgtgcaggaagccatgctggacaccctgcggttctggctggacctgggcatcgac
gggttccggctggacgcggtgccgtacctgttcgagcaggagggcacgaactgcgagaac
ctgccgcgcacgcacgacttcctcaagcgctgccgcaaggtggtcgacgacgagtacccc
ggccgggtgctgctcgccgaggccaaccagtggccctccgacgtcgtggagtacttcggg
gaccccgaagtgggcggcgacgagtgccacatggcgttccacttcccgctgatgccgcgg
atcttcatggcggtccgccgcgagtcgcggttcccgatctcggagatcctggcccagacg
ccgcagatcccggacggctgccagtggggcatcttcctgcgcaaccacgacgagctgacg
ctggagatggtcagcgacgaagagcgcgactacatgtacgccgagtacgccaaagacccg
cggatgaaggccaacatcgggatccgccggcggctcgcgcccctgctggagaacgatcgc
aaccagcaggaactcttcacggccatgctgctgtcgctgccgggatcgcccgtcctctac
tacggtgacgagatcggcatgggcgacaacatctggctcggggaccgggacgccgtccgc
acgccgatgcagtggaccccggaccgcaacgcggggttctcctcctgcgacccgggacgg
atctacctgccggtgatcatggacccggtctacggctaccagggcctgaacgtggaggca
cagctgaacaaccagtcatccctgctgaactggacccgccggatgatcgaggtgcgcaag
cagcaccacgcgttcgcggagggcgacttcaccgacctgggcggctcgaacccgagcgtc
ctggcctaccggcggcggtggcggcggccggacgggcacgaggacatcgtgctgtgcgtg
aacaacctgtcccggttcccgcagccggtcgagctggacctgtccgagcaccgcggcgcg
cgcccggtcgagctgaccggcggggtgcgcttcccgaccgtgggcgacctgtcctacctg
ttgacgctgcccggtcacggcttctactggttccaactggtcgaagcgggcgacgagggc
gagacgaggtga

DBGET integrated database retrieval system