KEGG   Saccharothrix espanaensis: BN6_75530Help
Entry
BN6_75530         CDS       T02404                                 

Definition
(GenBank) Superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sesp  Saccharothrix espanaensis
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN6_75530
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN6_75530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: CCH34778
UniProt: K0KE11
LinkDB All DBs
Position
8355250..8355663
Genome map
AA seq 137 aa AA seqDB search
MRLLSHILRRPLLEATAHCDLPCGVYDPAQARIEAESIKAVQEKYQANEDPEFRQRAVLI
KEQRSELVKHHLWVLWTDYFKPPHFEKYPELHDLFNRATKAAGASGTKGSMDPAKGQELL
DLIAQIDKIFWETKAAA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttctgtcgcacattctccgccgcccgctactggaggccaccgcgcactgcgac
ctcccgtgcggtgtctacgatccggcgcaggcccggatcgaggcggagtcgatcaaggcg
gtccaggagaagtaccaggccaacgaggaccccgagttccgccagcgcgccgtcctgatc
aaggaacagcgcagcgaactcgtgaagcaccacctgtgggtgctgtggaccgactacttc
aagcccccgcacttcgagaagtacccggaactccacgacctcttcaaccgcgccaccaag
gccgccggcgcgtccggcacgaagggctcgatggacccggcgaagggccaggagctgctc
gacctgatcgcccagatcgacaagattttttgggagacgaaggctgcggcctga

DBGET integrated database retrieval system