KEGG   Saccharothrix espanaensis: BN6_76900Help
Entry
BN6_76900         CDS       T02404                                 

Gene name
glpF
Definition
(GenBank) putative glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
sesp  Saccharothrix espanaensis
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sesp02000]
    BN6_76900 (glpF)
Transporters [BR:sesp02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    BN6_76900 (glpF)
Ion channels [BR:sesp04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   BN6_76900 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: CCH34911
UniProt: K0K967
LinkDB All DBs
Position
complement(8486042..8486782)
Genome map
AA seq 246 aa AA seqDB search
MSNGSIFVWEALGTAILILLGAGVVANVVLKKSAGNNGGWLLINFGWGLAVFAGASVAAP
SGAHLNPAVTLGLAVADKVEWGAVPFYVAGQMLGAFLGAVLAWLTYKVQFDTHDDPRNTR
GIFCTAPTVLAPGWNLVTEIIGTFVLVAWVLLSPGAKAAQDGVPQFGNSALGYAGVAFVV
IAIGASLGGPTGYAINPARDLAPRIAYAILPIRDKGSAEWGYSWVPVIGPLVGGLLAALL
YLALPV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatggctcgatcttcgtgtgggaagcgctcggcaccgcgatcctgatcctgctg
ggtgccggcgtcgtcgccaacgtcgtcctgaagaagtccgcggggaacaacggcggctgg
ctgctgatcaacttcggctggggtctcgcggtgttcgcgggcgccagcgtcgccgcgccc
agcggcgcacacctcaacccggcggtcaccctcggactcgcggtggccgacaaggtcgag
tggggcgcggtgccgttctacgtcgccgggcagatgctcggcgcgttcctcggcgcggtg
ctcgcctggctgacctacaaagtgcagttcgacacccacgacgacccccgcaacacgcgc
gggatcttctgcaccgcgccgaccgtgctcgcaccggggtggaacctcgtcaccgagatc
atcggcacgttcgtgctggtcgcctgggtgctgctcagccccggggcgaaggcggcgcag
gacggcgtcccgcagttcggcaactccgcgctgggctacgcgggcgtcgcgttcgtcgtc
atcgccatcggcgcctcgctcggcgggcccaccgggtacgccatcaaccccgcgcgcgac
ctcgcgccccgcatcgcctatgccatcctgccgatccgcgacaagggcagcgccgagtgg
ggctactcctgggtcccggtgatcggtccgctggtcggcggcctgctcgcggcgctgctg
tacctggccctcccggtctga

DBGET integrated database retrieval system