KEGG   Saccharothrix espanaensis: BN6_77670Help
Entry
BN6_77670         CDS       T02404                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00020  Citrate cycle (TCA cycle)
sesp00480  Glutathione metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01120  Microbial metabolism in diverse environments
sesp01130  Biosynthesis of antibiotics
sesp01200  Carbon metabolism
sesp01210  2-Oxocarboxylic acid metabolism
sesp01230  Biosynthesis of amino acids
Module
sesp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sesp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN6_77670 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN6_77670 (icd)
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BN6_77670 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCH34987
UniProt: K0KBR0
LinkDB All DBs
Position
complement(8581737..8582957)
Genome map
AA seq 406 aa AA seqDB search
MGKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVDLEYYDLGIEHRDATDDQVTIDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGAGELTITFTPQDGSEPIKHVVANYGPDGGVAM
GMYNFNKSIEDFARASFAYGLQRNYPVYMSTKNTILKAYDGAFKDIFQAVFESEFKDKFD
AAGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHFRQHQAGKPTSTNPIASIYAWTGGLKHRGKLDGTPEVTGFAETLE
QVIISTVESGKMTKDLAALVGRDQEWLTTEEFLGTLDENLQKKMAG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggttcaggggaccgtcgtcgaactcgacggcgacgagatgacccga
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtcgacctggag
tactacgacctgggcatcgagcaccgggacgccacggacgaccaggtgacgatcgactcg
gcgaacgccatcaagaagcacggcgtgggcgtcaagtgcgccaccatcaccccggacgag
gctcgggtcgaggagttcggcctgaagaagatgtgggtctcgccgaacggcacgatccgc
aacatcctcggcggcgtggtgttccgcgagccgatcatcatctccaacatcccgcggctg
gtgccgggctggaccaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gccaccaacttcaaggtgcccggcgcgggtgagctgaccatcaccttcacgccgcaggac
ggctccgagccgatcaagcacgtcgtggccaactacggccccgacggcggcgtggcgatg
ggcatgtacaacttcaacaagtccatcgaggacttcgcgcgcgcctcgttcgcctacggg
ttgcagcggaactacccggtgtacatgtcgacgaagaacacgatcctgaaggcgtacgac
ggtgccttcaaggacatcttccaggcggtcttcgagtccgagttcaaggacaagttcgac
gccgccggcctcacctacgagcaccgcctgatcgacgacatggtcgccgcggcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacgtcggtgctgatgaccccggacggc
cggaccgtcgaggccgaggcggcgcacggcacggtgacccggcacttccgccagcaccag
gccggcaagccgacctccacgaacccgatcgcctcgatctacgcgtggaccggcggcctc
aagcaccgcggcaagctggacggcacccccgaggtcaccggcttcgcggagacgctggag
caggtcatcatctcgaccgtcgagagcggcaagatgaccaaggacctggccgcgctggtg
ggccgggaccaggagtggctgaccaccgaggagttcctcggcacgctggacgagaacctg
cagaagaagatggccggctga

DBGET integrated database retrieval system