KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN0171Help
Entry
SEN0171           CDS       T00776                                 

Gene name
speE
Definition
(GenBank) Spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00270  Cysteine and methionine metabolism
set00330  Arginine and proline metabolism
set00410  beta-Alanine metabolism
set00480  Glutathione metabolism
set01100  Metabolic pathways
Module
set_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:set00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SEN0171 (speE)
   00330 Arginine and proline metabolism
    SEN0171 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SEN0171 (speE)
   00480 Glutathione metabolism
    SEN0171 (speE)
Enzymes [BR:set01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     SEN0171 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 MTS Methyltransf_31 FtsJ Methyltransf_12 MetW
Motif
Other DBs
NCBI-ProteinID: CAR31759
UniProt: B5R2R5
LinkDB All DBs
Position
complement(196790..197650)
Genome map
AA seq 286 aa AA seqDB search
MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDND
ALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHDALSAQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaatacgatgtggcatgaaacgctacacgaccagtttggtcagtactttgcc
gtagacaacgttctgtatcatgaaaaaaccgatcaccaggatttaatcatctttgaaaac
gccgcttttggccgcgtgatggcgctggacggcgtggtacagaccaccgaacgcgacgag
tttatttatcatgaaatgatgacccacgtcccgttgctggcgcacggtcatgcgaaacac
gttctgattatcggcggcggcgacggcgcaatgctacgtgaagttacccggcataaaaac
gtcgaaaccatcaccatggtagagatagacgctggcgtagtctcgttttgccgccagtat
ttacccaaccacaatgccggcagctacgacgatccgcgctttacgctagtgatcgacgac
ggcgtgaatttcgtcaatcagacccatcagacctttgatgtgatcatttccgactgtacc
gatccgataggccccggcgaaagcctgtttacctccgccttttatgaaggctgtaagcgt
tgcctgaatccgggcggcatttttgttgcccagaacggcgtgtgcttcctgcaacaggat
gaagcgctcgacagccaccgaaagctgagtcattacttcagcgatgtcggcttctaccag
gcggcgattccgacctactacggcggcatcatgaccttcgcctgggcgacggacaacgac
gctcttcgtcacctgtcgagcgaaattattcaggcgcgttttcatgccgccggcctcaaa
tgtcgctattacaacccggctattcatgccgctgcatttgcgctaccgcaatatctacat
gacgcactgtccgcacagtga

DBGET integrated database retrieval system