KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN0215Help
Entry
SEN0215           CDS       T00776                                 

Gene name
cdaR
Definition
(GenBank) carbohydrate diacid regulator (sugar diacid regulator)
  KO
K02647  carbohydrate diacid regulator
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Brite
KEGG Orthology (KO) [BR:set00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:set03000]
    SEN0215 (cdaR)
Transcription factors [BR:set03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SEN0215 (cdaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: CAR31803
LinkDB All DBs
Position
247900..249057
Genome map
AA seq 385 aa AA seqDB search
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VDIDNAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQPRVAAVVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQLISRMKE
NGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPESRSYFYQDLMLPVLLDSLRG
GWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVELQLDEQR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcatcttgataccaaaatggcgcaggatatcgtggcgcgcactatgcgc
atcatcgataccaatatcaacgtaatggatgcccgcgggcgtattatcggcagcggcgat
cgggaacgtattggtgaattgcacgaaggcgcgctgttagtgctgtcgcagggccgggtt
gtggatattgacaacgccgtggcgcgacacctgcacggggtgcgtcaggggattaatctt
cccttacgtcttgagggcgaaattgtcggcgtgatcggcctcaccggcgaaccagagcat
ctgcgtaaatatggcgaactggtgtgtatgactgccgaaatgatgctggagcagtcgcgg
ttaatgcaccttttggcgcaggatagccgtttgcgcgaagagctggtgatgaacctgatt
caggccgaagaaaatacgccggcgctggtggaatgggcgcagcgtttggggatcgatttg
aaccagccgcgtgtggcggcggtggtggaagtcgacagcggccagcttggcgtcgatagc
gcaatggcggaacttcagcagttgcagaatgcgcttaccacgccggagcgtaacaacctg
atagccattgtttctctcaccgagatggtggtgctcaaacccgccttaaactcgtttggt
cgctgggatgctgaagatcatcgtaagcgcgtagagcagcttatctcgcgaatgaaagag
aatggtcagctacgttttcgcgtggcgctgggcaattactttaccgggccgggcagtatt
gcacgttcataccgcacggcgcgcactacgatgatggtcggcaaacagcggatgccagaa
agccgcagctatttttatcaggatttgatgctgccggttctgttagatagcctgcgtggc
ggctggcaggccaatgagctggcgcgcccgctggtaaaactcaaagcgatggataacaac
gggttattacgtcggacgctgacggcgtggtttcgccataatgtccagccgctggcgacc
tctaaggcgctgtttattcatcgtaacacgctggaatatcggctaaatcgtatttcggaa
ctgaccgggctggatttgggaaattttgacgatcggctgttgctgtatgtggagctacaa
ttggatgaacagcgttaa

DBGET integrated database retrieval system