KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_07515Help
Entry
CFSAN001921_07515 CDS       T02737                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
setc00550  Peptidoglycan biosynthesis
setc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:setc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFSAN001921_07515
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CFSAN001921_07515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:setc01011]
    CFSAN001921_07515
Enzymes [BR:setc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CFSAN001921_07515
Peptidoglycan biosynthesis and degradation proteins [BR:setc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CFSAN001921_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGQ67633
LinkDB All DBs
Position
complement(1549846..1551717)
Genome map
AA seq 623 aa AA seqDB search
MTFKDFDAEEKLFLRRVIVAFGVVVVCFGILIFNLYNLQIRQHHYYTTRSNENDIKMLPV
APTRGIIYDRNGIPLVRNVTWYDIAVTPYKIADMDALLKQLTPIVDLSPDDISDFRRALK
SSSRYRPVVLKNALTDVEIARFAVNQFHFNGVTINSYQDRQYPYGAELAHVLGYVSKIND
NDLKALDKKGLAENYAADHNIGKQGIERYYENDLHGKTGYQEVEVDNHGRIVRLLKDVPP
IAGKNIHLTLDLHLQEYIESLLAGQRAAVLVEDPHDGSVLAMVSMPSYDPNPFVKGISYQ
DYGKLLHDKNLPLINRVTQGLYPPASTVKPYMAMSALLCGIITPQTTFFGAPTWTLPGTQ
RHYRDWKKTGHGMLDVTKAIEESADTFFYQVAYMMGIDRIDTMLSQFGYGKPTGIDLNEE
YDGLLPSRAWKQRVHKKAWYQGDTISVGIGQGYWIATPIQMVKAMVALINNGKVIAPHLL
LNEESGKTVVPYRPSGTPAQIADPASPYWGLVRQAMYGMANAPNGTGYKFFHTAPYGIAA
KSGTSQVFSLKENQTYNAKMIPIRLRDHVFYTAFAPYKNPKVAIALILENGGSDGVTAAP
IMRKILDHLFDPQADTTQPDQAP
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaagactttgatgcggaagagaaactcttcctgagacgtgtgattgtggcg
tttggtgtagtggttgtctgctttggtatcctgatcttcaacctctataacttgcaaatc
cgccagcaccactactacaccacccgttcgaatgagaacgatatcaagatgctacccgtc
gcgcccacgcgcggcatcatttacgatcgcaacggcattccgctggtgcgtaacgtaacc
tggtatgatatcgcggttacgccctataaaattgccgatatggatgcgctgctaaaacag
ctcacccctattgttgatctctcccccgacgatatctccgactttcgccgtgcgctaaaa
tccagtagccgctatcgtccggtggtgctcaaaaacgcgctaacggatgttgaaatcgca
cgctttgcggtcaatcagtttcatttcaacggcgtcacgatcaatagctatcaggatcgg
cagtatccttacggcgcggagctggcgcatgttctcggttacgtgtcaaagataaacgat
aacgaccttaaagcgctggataaaaaagggctggcagagaattacgcggcggaccataac
atcggtaaacaggggattgagcgttactacgaaaacgatcttcatggtaaaaccggttat
caggaggtcgaggtggataatcacgggcgtattgtccgcctgctgaaagacgttcctccc
atcgcgggtaagaacattcacctgacgctggatctccatttacaagagtacattgaaagt
ttgctggccgggcagcgtgctgccgtactggttgaagatccgcacgatggttcagtgctg
gcgatggtatctatgcccagctacgacccgaacccctttgtaaaaggcattagctatcag
gattacggcaaactgctgcacgataaaaatctgccgctgatcaaccgcgtgacgcaaggg
ctttatcctccggcgtcaacggttaaaccctatatggcaatgtccgcgctgttatgcggg
attattacgccgcaaaccaccttctttggcgcgccaacctggacgcttcccggcacgcag
cggcattaccgggactggaaaaaaaccggacacggtatgctggatgtcactaaagcgatt
gaggaatctgcggatacctttttctatcaggtcgcttatatgatgggtattgaccgtatc
gacacgatgttgtctcagttcggctatggcaaaccgacgggcatcgaccttaatgaagaa
tatgacgggctgcttcccagccgcgcatggaaacagcgggtccataaaaaagcctggtat
cagggcgataccatttctgtcggcatcggccagggttactggattgccacccccatccag
atggtaaaagcgatggtggcgctcatcaacaacggtaaggtgattgcccctcacctgtta
ctcaatgaagagagcggcaaaacggtggttccgtatcgtccttcaggaacaccggcacag
atagccgatccggcgtcgccatactggggactggtgcgtcaggcgatgtatggcatggcg
aatgcacccaacggaacgggctataagttctttcacaccgcgccctacggcattgcggcc
aaaagcggcacgtcgcaggtatttagcctgaaagaaaatcagacctacaacgcgaaaatg
atccccattcgcctgcgcgatcatgtgttttataccgcttttgcaccgtataaaaaccct
aaggtcgctattgccttgattctggaaaacggcggaagcgacggcgttaccgccgcaccc
atcatgcgaaaaatccttgaccacctgtttgatccacaggctgataccacacagccggat
caggcgccatag

DBGET integrated database retrieval system