KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_11860
Entry
CFSAN001921_11860 CDS       T02737                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Brite
KEGG Orthology (KO) [BR:setc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:setc03009]
    CFSAN001921_11860 (rlmL)
Enzymes [BR:setc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     CFSAN001921_11860 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     CFSAN001921_11860 (rlmL)
Ribosome biogenesis [BR:setc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CFSAN001921_11860 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_15 Methyltransf_24 N6_Mtase
Other DBs
NCBI-ProteinID: AGQ68316
LinkDB
Position
complement(2412896..2415004)
AA seq 702 aa
MNSLFASTARGLEELLKTELEKLGAVGCQVVQGGVHFQGDTRLIYQSLMWSRLASRIILP
MGECKVYSDLDLYLGVQAINWTEIFNPGATFAVHFSGLNDTIRNSQYGAMKVKDAIVDAF
TRKNLPRPNVDRESPDLRINVWLNKETASIALDLSGDGLHLRGYRDRTGLAPIKETLAAA
IVMRSGWQPGTPLLDPMCGSGTLLIEAAMWATDRAPGLHRGHWGFSGWAQHDETIWQEVK
AEAQTRARKGLAEYSSHFYGSDSDARVIERARSNARRAGIGELITFEVKDVAQLSNPLPK
GPYGTVISNPPYGERLDSEPALIALHSLLGRTMKNQFGGWNLSLFSASPDLLGSLQLRAD
KQFKAKNGPLDCVQKNYHIAETTADSKPATVAEDYANRLRKNLKKLEKWARQEGIECYRL
YDADLPEYNVAVDRYGDWAVIQEYAPPKTVDAQKARQRLFDIIAATLSVLGIPPNKLVLK
TRERQKGKNQYQKMSEKGEFLEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGEMSKGK
DFLNLFSYTGSASVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLSGRAHRLIQADCLG
WLREANEQFDLIFIDPPTFSNSKRMEESFDVQRDHVALMKDLKRLLRKGGTIMFSNNKRG
FRMDLEGLAELGLTAQEITQKTLSPDFARNRQIHNCWLIRAA
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgaattctctgtttgccagtacggcccgcgggctggaagagctgttaaaaactgaactg
gaaaaactgggcgccgtagggtgtcaggttgttcagggtggggtccattttcagggcgac
acgcggcttatttaccagagcctgatgtggagccgcctggcctcgcgtattatcctgccg
atgggtgagtgcaaggtctacagcgatctcgatctttacctcggcgttcaggcgataaac
tggacagagatttttaatcctggcgcgacgtttgcggtgcatttcagcggcctgaacgac
accatccgtaatagtcagtatggcgcgatgaaagttaaagacgcgattgtcgatgcgttt
acgcggaaaaatcttccgcgtccaaatgtggaccgcgaatcgccggacctccgtattaac
gtctggctgaataaagaaactgccagcattgcgctggatctcagtggtgatggcctgcac
ctgcgcggttatcgcgatcgcaccgggctggcgccaattaaagagacgctggcggcagcg
attgttatgcgttccggctggcaaccaggtacgccgctgctcgaccctatgtgtggttcg
gggacactgttgattgaggccgcgatgtgggcgaccgatcgcgcgccgggcctgcaccgt
ggtcactggggatttagcggctgggcacagcatgacgaaactatctggcaggaagtgaaa
gccgaagcgcagacccgggcgcgtaaggggctggcggagtattcctctcatttctacggt
tccgacagcgatgcgcgcgtcattgagcgggcgcgcagcaacgcccgtcgcgccggtatc
ggcgagcttatcacctttgaagtgaaagatgtggcgcaactgagtaatccattgccgaaa
ggcccgtatggtacggtgatcagtaacccgccttacggcgaacgtctggacagcgaaccg
gcgctgattgcgttgcacagcctgctgggccgtaccatgaaaaatcagtttggcggctgg
aacctgtcgctgttcagcgcttcgcccgatctgctgggcagcctgcaattacgtgccgac
aaacagtttaaagccaagaatggcccgctggactgcgtgcagaaaaactatcatattgcg
gaaaccacggcggacagtaaaccggcgacggtggcggaagattacgctaatcgcctgcgt
aaaaatcttaaaaagctggagaaatgggcgcgccaggaagggattgaatgctatcgcttg
tatgatgccgacctgccggaatataacgtggcggtagaccgttacggcgactgggcggtg
attcaggaatatgcgccgccgaaaacggtggatgcgcaaaaagcgcggcaacgtctgttc
gatattattgcggcaaccttgtcagtgctcggtattccgccgaataaactggtgttaaaa
acccgtgaacggcaaaaaggaaaaaaccagtatcagaaaatgagcgagaagggcgagttc
cttgaggtcagcgaatataatgcgcgcttatgggtaaatctgacggattatctcgacacc
ggtctgttcctcgatcaccgtattgcccgcagaatgctgggagaaatgagcaaaggcaaa
gatttcctgaatctcttttcttataccggcagcgccagcgtacatgcgggtctgggcggc
gcgcgcagcaccacaacggtggatatgtcccgcacctatctggagtgggccgaacgtaat
ttgcgtctgaacggactgagcggccgcgcgcatcgcctgattcaggccgactgcctgggc
tggctgcgcgaggcgaatgaacagttcgatttgatctttatcgatccgccgacgttctct
aactcaaaacgtatggaagagtcgtttgatgttcagcgcgatcatgtcgcgttaatgaaa
gatttaaaacgcctgctgcgtaaaggcggcaccatcatgttctcaaataataagcgcgga
ttccgtatggatctggaagggctggcggaactggggcttaccgcacaagaaattacgcaa
aaaacgctctccccggattttgcccgtaaccgtcagattcataactgctggctgatccgc
gccgcctga

DBGET integrated database retrieval system