KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_13375Help
Entry
CFSAN001921_13375 CDS       T02737                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase cytochrome b556 large membrane subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
setc00020  Citrate cycle (TCA cycle)
setc00190  Oxidative phosphorylation
setc00650  Butanoate metabolism
setc01100  Metabolic pathways
setc01110  Biosynthesis of secondary metabolites
setc01120  Microbial metabolism in diverse environments
setc01200  Carbon metabolism
Module
setc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
setc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
setc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:setc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFSAN001921_13375 (sdhC)
   00650 Butanoate metabolism
    CFSAN001921_13375 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFSAN001921_13375 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AGQ70640
LinkDB All DBs
Position
complement(2721675..2722079)
Genome map
AA seq 134 aa AA seqDB search
MWALFMIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILLWLLGTSLSSP
EGFQQAADIMDGFIVKFIMWGILTALAYHVIVGIRHMLMDFGYLEETFEAGQRSAKISFV
ITVVLSLLAGVLVW
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgttattcatgataagaaatgtgaaaaaacaaagacctgtcaatctggatcta
caaacgattcggttccccatcacagcgatagcgtccattctccatcgcgtatccggtgtg
attactttcatcgccgtcggcatactactgtggctactgggcaccagcctctcttctccg
gaaggattccagcaggccgccgacatcatggacggcttcatcgttaaatttatcatgtgg
ggcatccttaccgcgctggcgtatcacgtcatcgtgggaattcgtcacatgttaatggat
tttggctatctggaagaaacattcgaagcgggtcaacgctctgccaaaatctcttttgtt
atcactgtcgtgctttcacttctcgcaggagtcctcgtatggtaa

DBGET integrated database retrieval system