KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_16000
Entry
CFSAN001921_16000 CDS       T02737                                 

Definition
(GenBank) type VI secretion protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Brite
KEGG Orthology (KO) [BR:setc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:setc02044]
    CFSAN001921_16000
Secretion system [BR:setc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CFSAN001921_16000
SSDB
Motif
Pfam: T6SS_VasE DALR_1
Other DBs
NCBI-ProteinID: AGQ68936
LinkDB
Position
complement(3245752..3247095)
AA seq 447 aa
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKL
ILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPES
LARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRI
DIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLTGSDNHGHEAAEVSDYLLL
QILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQTRRPAEYKEYKHLTPYAGL
KSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLAIKASMPTDVL
LQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagctggaatgaccgcgtagtctggagtgaaggacaatttttactgccgcagatgttt
cagcagcaagagcgttatctggaacacgtcatgcattaccgcagcctgccgctgaccccc
tttttctggggattcagccactacaatattgatggcgaagcgctgaacatcggtaaactg
atactgaaagaggcatcagggatttttcctgacggcacgccgtttaacgcaccggaccac
accccgctgccgccgccactgaccattctgccggagcacctgaaccagcagatttgtctg
gcggtaccggtacgcgcgccgaacagcgaagaaaccacgtttgacaataacccggaatca
ttggcgcgtttctcggtacatgaacacgacatccgcgacgccaactcgctgggacgtggc
gcgcagttattacagctcagtcatctgcgcctgcggctgctgccggaaaaggcggtgacg
ggcgcctggattggcctgccgttgacccgcatcaccgggttgaaccctgacgggcggata
gatatcgaccacgacctgatcccgcccatcattaattatcaggccagttcactgatgtgt
acctggctgtcgtggatcaacgatctcatccggatgcgggccgattcgctggcggaacgg
ctgaccggcagcgacaaccacggccatgaagcagcggaggtctccgattacctgctgctg
caaattctcaatcgctttgagccgctgctgactcacctggcgaaaaccccgctggccccg
gaggtgctgtaccgctacctgtccgaactggccggggaactctccacctatgtgcgtcca
caaacgcgacggcccgctgaatacaaagagtacaaacacctgacgccctatgccgggttg
aaatcgctggttgatgaggtgcagttcctgctgaacgcggtactgatccggggcgcgcag
cgcatcgagctgaaagaggggacttacggcatcctgaatgcggtggtggccccttccgat
cttgccgatttcagcacgctggtactggcgataaaggcttcaatgccgaccgatgtgcta
ctgcaacattttgccgcccagaccaaaatcgggccatccgatcgcctgccggaactgatc
cgctcgcatctgccggggctggctttgcaggttctgcctgtaccaccgcgccaaatcccg
tttcaggccggatacatctattacgacatccgccgcgagggagcattgtgggaacacatt
gcccgttacggcgggatggccatgcataccgccggggaatttccggggctggagacagaa
ctgtggggagtgcgcgataaatga

DBGET integrated database retrieval system