KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_05775Help
Entry
STU288_05775      CDS       T02639                                 

Definition
(GenBank) DNA polymerase III subunit theta
  KO
K02345  DNA polymerase III subunit theta [EC:2.7.7.7]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu03030  DNA replication
setu03430  Mismatch repair
setu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:setu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STU288_05775
   03430 Mismatch repair
    STU288_05775
   03440 Homologous recombination
    STU288_05775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:setu03032]
    STU288_05775
   03400 DNA repair and recombination proteins [BR:setu03400]
    STU288_05775
Enzymes [BR:setu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STU288_05775
DNA replication proteins [BR:setu03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STU288_05775
DNA repair and recombination proteins [BR:setu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     STU288_05775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_theta MMM1
Motif
Other DBs
NCBI-ProteinID: AGK08763
LinkDB All DBs
Position
1184810..1185040
Genome map
AA seq 76 aa AA seqDB search
MKTNLAQLEQAEMDKVNVDLAAAGVAFKERYNMPVVAEAVEREQPEHLRAWFRERLIAHR
LASVSLSRLPYEPKVK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaatctggctcagcttgaacaagcggaaatggataaagtcaatgtggacctg
gcggcagccggggtggcatttaaagagcgctacaatatgccagttgtcgcggaggcggtc
gaacgtgagcagccagagcatctacgcgcctggtttcgcgagcggctgattgcccatcgt
ctggcttccgtatcactatcccgactcccttacgaacccaaagttaaataa

DBGET integrated database retrieval system