KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_17665Help
Entry
STU288_17665      CDS       T02639                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1a
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu00550  Peptidoglycan biosynthesis
setu01100  Metabolic pathways
setu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:setu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STU288_17665 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    STU288_17665 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:setu01003]
    STU288_17665 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:setu01011]
    STU288_17665 (mrcA)
Enzymes [BR:setu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     STU288_17665 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STU288_17665 (mrcA)
Glycosyltransferases [BR:setu01003]
 Polysaccharide
  Bacterial polysaccharide
   STU288_17665 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:setu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   STU288_17665 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AGK11129
LinkDB All DBs
Position
3643644..3646196
Genome map
AA seq 850 aa AA seqDB search
MKFVKYLLILAVCCILLGAGSIYGLYRYIEPQLPDVATLKDVRLQIPMQVYSADGELIAQ
YGEKRRIPVTLDQIPPEMINAFIATEDSRFYEHHGIDPVGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAIRIEQLLNKNEILELYLNKIYLGYRAYGVGAAA
QVYFGKTVDQLSLSEMAVIAGLPKAPSTFNPLYSMDRAIARRNVVLSRMLSEGYITQAQY
DQARSEPIDANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQ
QAVRNNVLDYDMRHGYRGPANVLWKVGETAWDSKKITDTLKALPTYGPLLPAVVTSANPQ
EATAALADGTSVSLHMEGMRWARPYRSDTQQGPTPRKVTDVVQTGQQIWVRQVDNDWWLA
QVPEVNSALVSLNPQTGAVLALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLASMLNDVPISRWDAGAGSDWRPKNSPPQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPMQVARGYAVMANGGFLIDPYFISKIENDQG
GVIFEAKPKIACPECDIPVIYGNTQKSDVLENTNVEEVAVSQEQQNSAVPMPELEQANQA
LVAQNGTQEYAPHVINTPLAFLIKSALNTNIFGEPGWMGTGWRAARDLKRRDIGGKTGTT
NSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIKDQISGYEGGAKSAQPAWDAY
MKAVLEGVPEQPLTPPPGIVTVNIDRSTGQLASGGNSREEYFIEGTQPTQQAVHEVGTTI
IDNGETHELF
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattgatccttgcagtatgttgcatcctgctgggagcaggc
tcgatttatggcctttatcgctatattgagccacagctacctgacgtcgcgacattgaaa
gatgtgcgtttgcaaattccgatgcaggtttacagcgcggatggcgaacttatcgcgcaa
tatggcgaaaaacgtcgtattcccgttacgctcgatcaaattccgccggaaatgatcaac
gcctttatcgccaccgaagatagccgcttttatgagcatcacggcattgacccggtaggt
attttccgtgcggccagcgtcgcgctcttctccggtcacgcatcgcagggagcaagtacc
attacccagcaactggcgcgaaacttcttccttagccccgaacgcacgctgatgcgcaag
atcaaggaagcgtttctggcgattcgtattgagcagttgctgaataaaaatgagatcctc
gaactctatctgaacaagatctatctcggctaccgcgcctatggcgttggcgcggcggca
caggtctactttggtaagacggtcgaccagcttagtctaagcgaaatggcggttatcgcc
gggctaccgaaagcgccttctacctttaacccgctctactcgatggatcgggcgatagcg
cgccgtaacgtagtgctttcgcgaatgttaagcgagggatatatcactcaggcgcagtac
gatcaggcccgtagcgaacctatcgacgcaaattatcacgcgccggaaatcgccttctcc
gcgccttatctgtcggaaatggtgcgccaggaaatgtataaccgttatggcgaaagcgct
tacgaagatggttatcgtatttacacgaccatcacccgcaaagtgcagcaggccgcgcaa
caggcggtgcgtaataacgtgctggactatgacatgcgccacggttatcgcggcccggcg
aatgtgctatggaaagtgggcgaaacagcgtgggacagtaaaaaaattaccgatacgttg
aaagcgttgccgacctacggaccgctgcttcccgccgtggtcaccagcgctaatccgcaa
gaggcgaccgctgcgcttgccgacggtacgtccgtttcgctacatatggaaggaatgcgt
tgggcgcggccttaccgctcggatacgcagcaggggccgacgccgcgtaaagttaccgat
gtcgtccagacaggtcagcaaatctgggttcgtcaggtggataacgactggtggctggcg
caggtaccggaagtgaactccgcgctggtttcgcttaacccgcaaacaggcgcggtactg
gcgctggtcggcggtttcgattttaatcagagtaaatttaaccgcgcgacgcaagctttg
cgtcaggtggggtcgaacatcaaaccgttcctctacaccgccgcaatggataaagggctg
acgctcgccagtatgctcaacgatgtgccgatttcccgctgggacgccggggcaggttca
gactggcgtccgaaaaactccccgccgcagtacgccggaccgattcgtttacgccagggg
ctggggcagtcgaaaaacgtggtgatggtacgcgccatgcgcgccatgggcgtcgactat
gcggcggagtatttgcaacgcttcggcttcccggcgcagaatatcgtgcataccgaatcg
ctggcgctgggctccgcctccttcacgccgatgcaggttgcgcgcggttatgcggtgatg
gcgaacggcggtttcctgatcgacccgtatttcatcagcaagattgagaacgatcagggc
ggcgtgatcttcgaagcgaaaccgaaaatcgcctgcccggagtgcgatatcccggtcatt
tacggcaatacgcagaaatctgacgtgctggaaaacaccaatgtggaagaggtcgcggtt
tcgcaagagcagcaaaacagcgccgtaccgatgcctgagctggaacaggcaaaccaggcg
ctggtcgcgcaaaacggcacgcaggaatacgcgccgcatgtgatcaatacgccgctggcg
tttctgatcaaaagcgcgctgaacaccaatatctttggcgaacccggctggatgggtacc
ggctggcgtgcggcgcgcgaccttaaacgtcgcgatatcggcggcaaaaccggtacgacc
aacagctcgaaagacgcatggttctccggctatggtcctggcgtcgtcacttccgtatgg
atcggctttgacgatcaccgccgtgatttaggccgcaccaccgcttccggcgcgatcaaa
gatcaaatctccggctatgagggcggcgcgaagagcgcgcaacctgcatgggacgcctat
atgaaagccgtgctggaaggcgtgccggaacagccgctaacgccgccgccgggcatcgtc
acggtgaatatcgaccgcagtaccggacaactggcgagcggcggtaacagccgtgaagag
tatttcatcgaaggcacgcagccgacacaacaggcggtacacgaggtgggaaccaccatt
attgataatggtgaaacacacgaactgttctga

DBGET integrated database retrieval system