KEGG   Streptococcus equi subsp. equi 4047: SEQ_1160Help
Entry
SEQ_1160          CDS       T00877                                 

Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00240  Pyrimidine metabolism
seu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SEQ_1160
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SEQ_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: CAW93850
UniProt: C0MC14
LinkDB All DBs
Position
1144067..1144636
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAV
PISNDMDIFAFIAELQEKPYCVLIDECQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTEHGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaattatattacaaatatggaacaatgaattcaggaaagaccattgaaatcttg
aaggtagcacacaattatgaagaacaggggaagcctgttgtgattatgacaagtgcgcta
gacacacgtgatggctttggcattgtttctagtcggattggcatgcgtcgtgaggctgta
ccaatttcgaatgatatggatatttttgcatttattgctgaattgcaggagaagccctat
tgcgtcttgattgacgaatgtcaatttttaagcaagcaaaatgtctatgatttagcacgt
gtggttgatgagctaaatgttccagtgatggcctttggcttaaaaaatgattttcaaaat
gaattgtttgaaggctccaaatacctgttactgttagctgataagattgatgagataaaa
accatctgtcaatattgcagcaaaaaagcaactatggtattgcgaacagaacatggtaag
cccgtttatgagggagcacagattcaaattggtggcaatgagacctatattccagtttgt
cgcaagcattattttcacccaccaatctaa

DBGET integrated database retrieval system