KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_08241Help
Entry
STMMW_08241       CDS       T01715                                 

Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00010  Glycolysis / Gluconeogenesis
sev00260  Glycine, serine and threonine metabolism
sev00680  Methane metabolism
sev01100  Metabolic pathways
sev01110  Biosynthesis of secondary metabolites
sev01120  Microbial metabolism in diverse environments
sev01130  Biosynthesis of antibiotics
sev01200  Carbon metabolism
sev01230  Biosynthesis of amino acids
Module
sev_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sev_M00002  Glycolysis, core module involving three-carbon compounds
sev_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMMW_08241
  09102 Energy metabolism
   00680 Methane metabolism
    STMMW_08241
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STMMW_08241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sev04131]
    STMMW_08241
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sev04147]
    STMMW_08241
Enzymes [BR:sev01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STMMW_08241
Membrane trafficking [BR:sev04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    STMMW_08241
Exosome [BR:sev04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STMMW_08241
  Exosomal proteins of melanoma cells
   STMMW_08241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBG23832
LinkDB All DBs
Position
complement(875014..875766)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system