KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_08811Help
Entry
STMMW_08811       CDS       T01715                                 

Definition
(GenBank) glutamine-binding periplasmic protein precursor
  KO
K10036  glutamine transport system substrate-binding protein
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sev00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STMMW_08811
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sev02000]
    STMMW_08811
Transporters [BR:sev02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    STMMW_08811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: CBG23889
LinkDB All DBs
Position
complement(934916..935662)
Genome map
AA seq 248 aa AA seqDB search
MKSLLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVELWDAIAKE
LKLDYTLKPMDFSGIIPALQTKNIDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANN
NDIKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDT
PNILYFIKTAGNGQFKAVGESLEAQQYGVAFPKGSDELREKVNGALKTLRENGTYNEIYK
KWFGTEPK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctctattaaaagtttcactggctgcacttaccctggcttttgcggtgtcttcg
cacgctgcggataagaaactcgttgtggcaaccgatacggcgttcgttccgtttgaattt
aaacagggcgacaaatacgtcggttttgatgttgaactgtgggacgctatcgcgaaagaa
ctgaagctggactacaccctgaaaccgatggatttcagcggcattattccggcattacaa
accaaaaatatcgatctggcgctggcgggtattacgattacggacgagcgtaaaaaagcg
atcgacttttccgatggctattacaaaagcggtctgctcgtgatggtgaaagccaacaat
aacgatattaaaagcgttaaagacctcgatggcaaagtcgttgccgtgaagagcggaacc
gggtcggtggattacgcgaaagcgaatatcaaaaccaaagacctgcgtcagttcccgaac
attgataacgcgtacatggaattaggcaccaaccgcgcagacgccgttctgcacgatacg
ccgaacatcctgtactttatcaaaaccgcaggcaacggccagttcaaggcggtaggcgaa
tcgctggaagcacagcaatacggagttgccttcccgaaaggcagcgatgaactgcgcgag
aaagtcaacggcgcgctgaaaacgctgcgtgagaatggcacctataacgaaatctacaaa
aaatggttcggtacagaacctaaataa

DBGET integrated database retrieval system