KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_10551Help
Entry
STMMW_10551       CDS       T01715                                 

Definition
(GenBank) superoxide dismutase precursor (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
Enzymes [BR:sev01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STMMW_10551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBG24067
LinkDB All DBs
Structure
PDB: 

Position
complement(1125914..1126447)
Genome map
AA seq 177 aa AA seqDB search
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNG
LTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLV
VNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacacaatattgtcgctggtagctggtgcgctcatcagttgttcagcaatggca
gagaataccctgactgtaaagatgaacgatgccctgtccagcggaacaggagaaaacata
ggtgaaatcacagtttcagagacaccttacggtctgcttttcactcctcacctaaatggt
cttacgccaggaattcacggcttccatgtccacacaaacccaagttgtatgccgggaatg
aaagacggtaaagaggttccggcgctcatggccggaggacatcttgaccccgaaaaaacc
gggaaacatcttggcccatataatgacaaagggcatttgggggatctgcctggactggtt
gtcaatgcagatggtacagccacgtatccgttactggcaccacgccttaaatcactgtca
gaactgaaaggtcactcattgatgatccataaaggcggtgacaattactccgataaacct
gctccactgggtggtggcggtgcacgttttgcctgtggtgtcattgagaaataa

DBGET integrated database retrieval system