KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_12061Help
Entry
STMMW_12061       CDS       T01715                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00061  Fatty acid biosynthesis
sev00780  Biotin metabolism
sev01100  Metabolic pathways
sev01212  Fatty acid metabolism
Module
sev_M00083  Fatty acid biosynthesis, elongation
sev_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sev00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    STMMW_12061
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    STMMW_12061
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sev01004]
    STMMW_12061
Enzymes [BR:sev01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     STMMW_12061
Lipid biosynthesis proteins [BR:sev01004]
 Fatty acid synthase
  Component type
   STMMW_12061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: CBG24218
LinkDB All DBs
Position
1276271..1277476
Genome map
AA seq 401 aa AA seqDB search
MLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCDDIISRKEQRKMD
AFIQYGIVAGVQAMQDSGLEVTEENASRIGAAIGSGIGGLGLIEENHSSLVKGGPRKISP
FFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADAMVAGGAE
KASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKARGA
KIYAEIVGFGMSSDAYHMTSPPENGAGAALAMVNALRDAAIEPAQIGYVNAHGTSTPAGD
KAETQAVKSVFGDAASRVMVSSTKSMTGHLLGAAGAVESIFSILALRDQAIPPTINLDNP
DEGCDLDFVPHEARQVSDLEYALCNSFGFGGTNGSLIFKKI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctcctgtcggcaataccgtagagtctacctggaaagctctccttgccggtcag
agtggcatcagcctgatcgaccatttcgatactagcgcctatgcaacgaaatttgctggc
ttagtaaaggattttaactgtgatgacattatctcgcgcaaagaacagcgcaagatggat
gccttcattcaatatggaattgtcgctggcgtacaggccatgcaggattctggccttgaa
gtgacggaagagaacgcaagccgtattggcgccgctatcggctccggtatcggtggtctc
ggtctgatcgaagaaaaccacagttcgctggtaaaaggcggaccgcgtaagattagcccg
ttctttgtcccgtcgacgattgttaacatggtagcaggccatctgactatcatgtatggc
ctgcgtgggccaagcatctctattgcgactgcctgtacttcaggcgtgcataacatcggc
catgccgcgcgtatcatcgcctatggcgatgcggacgcgatggtggcaggtggcgcagaa
aaagccagtacgccgctgggtgtaggtggttttggcgcagcgcgcgcgctgtcgacccgc
aacgataacccacaggcggcgagccgtccgtgggataaagaacgcgatggttttgtactg
ggcgacggtgccggtatgttggtgcttgaagagtacgaacatgcaaaagcgcgtggtgcg
aaaatctatgccgaaatcgtcggctttggtatgagcagcgatgcttaccatatgacgtcg
ccgccggaaaatggcgcaggcgctgcgctggcgatggttaacgcgttgcgtgatgccgcg
attgagcctgctcagattggctacgtcaacgcgcacggcacgtcgacgcctgccggcgac
aaagctgagacgcaggcggttaagtcagtctttggcgatgctgcaagccgagtgatggtg
agctcgaccaaatcgatgaccggccatctgttgggcgccgcaggcgcagtagagtctatt
ttctctattctggcgctgcgcgatcaggccattccgccaaccattaatctggataacccg
gatgaaggttgcgatctggacttcgtgccgcatgaagcgcgccaggtcagcgatctggag
tacgctctgtgcaactcctttggttttggcggaactaacggttccttgatctttaaaaag
atctaa

DBGET integrated database retrieval system