KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_12101Help
Entry
STMMW_12101       CDS       T01715                                 

Definition
(GenBank) DNA polymerase III, delta' subunit
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev03030  DNA replication
sev03430  Mismatch repair
sev03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sev00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STMMW_12101
   03430 Mismatch repair
    STMMW_12101
   03440 Homologous recombination
    STMMW_12101
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sev03032]
    STMMW_12101
   03400 DNA repair and recombination proteins [BR:sev03400]
    STMMW_12101
Enzymes [BR:sev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STMMW_12101
DNA replication proteins [BR:sev03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STMMW_12101
DNA repair and recombination proteins [BR:sev03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     STMMW_12101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C LcnG-beta EPF
Motif
Other DBs
NCBI-ProteinID: CBG24222
LinkDB All DBs
Position
1280062..1281066
Genome map
AA seq 334 aa AA seqDB search
MKWYPWLRPAYEKLVESYQAGRGHHALLIQALPGMGDEALCYALSRYLLCQQPEGHKSCG
HCRGCQLMQAGTHPDYYTLTPDKGKSSLGVDAVREVSEKLYEHSRLGGAKVVWIADAALL
TDAAANALLKTLEEPPEQTWFFLASPEPARLLATLRSRCRLHHLAPPSESYAMSWLSREV
TASQEALLTALRLNAGSPGAALALLQSERWAQREALCQALMDSLHTGDWYAVLTALNHEQ
APARLHWLATLLVDALKRQHGASYLTNVDADAVVAALAGPLSPARIQAILNDVCHCRDQL
LHVTGLNRELVLTDLILRIEHYLQPGTLLPVPHL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtatccatggttacggcccgcctatgaaaaactggtagaaagttaccaggcg
ggacgtgggcaccatgcgctactgattcaggccttacctggcatgggcgacgaggcgctg
tgctatgcgctgagccgttatctgttatgccagcagcctgagggccacaaaagctgtggg
cattgccgtggctgtcagcttatgcaggctggcacgcatccggactattacacgctgacg
ccggataaaggcaaaagcagcctcggcgtagatgcggtacgcgaggtcagcgagaaattg
tacgagcactcccgtctgggcggcgcgaaggtggtgtggattgcggatgcggcgctatta
accgacgccgccgccaatgcgttgctcaaaacgctggaagagccgccggagcaaacctgg
tttttccttgccagcccggagcctgctcgtctgttggcgacattacgcagccgctgccgg
ctgcatcatctggcgccgccgtccgaatcgtatgcgatgtcatggctgtcgcgagaagtg
acggcgtcacaagaagcattgctcacggcgctacgtctgaatgcggggtcgcccggcgcc
gcgctggcgctgttgcagtctgaacgctgggcgcagcgtgaggcgctgtgtcaggcgtta
atggacagtttgcatacgggcgactggtatgcggtattaacggcgctcaatcatgagcaa
gccccggcgcgcctgcactggctggcgacgctgctggtagacgcgctgaaacgtcagcac
ggcgcgtcgtacctgacaaacgttgatgcggacgcggttgttgccgcgctggcggggccg
ctatccccggcgcgtattcaggcaatcctgaacgatgtttgccattgtcgtgatcaatta
cttcatgtgaccggattaaaccgcgaactggtattaaccgatctcattctccgcatcgag
cattacctgcaaccaggcaccttgttgcctgttcctcatctttga

DBGET integrated database retrieval system