KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_20611Help
Entry
STMMW_20611       CDS       T01715                                 

Definition
(GenBank) precorrin-8W decarboxylase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00860  Porphyrin and chlorophyll metabolism
sev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sev00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STMMW_20611
Enzymes [BR:sev01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     STMMW_20611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PrmA Methyltransf_31 Methyltransf_25 Methyltransf_12 GidB Cons_hypoth95 Methyltransf_4 Methyltransf_11 Met_10 Methyltransf_23 CMAS Methyltransf_2 PCMT Methyltransf_18 RrnaAD DOT1 Methyltr_RsmB-F UPF0020 Pyr_redox Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: CBG25069
LinkDB All DBs
Position
complement(2132172..2132750)
Genome map
AA seq 192 aa AA seqDB search
MKDELFLRGENVPMTKEAVRALALSKLELHRASHLIDVGAGTGSVSIEAALQFPSLQVTA
IERNPAALRLLDENRQRFACGNIDILPGEAPMTITGKADAVFMGGSGGHLTALIDWAMGH
LHPGGRLVMTFILQENLHSALAHLAHIGACRMDCVQLQLSSLTPLGAGHYFKPNNPVFVI
ACQKEENHVRDI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctttttctgcgcggcgagaacgtgccaatgaccaaagaggcggtacgg
gcgctggcactgtcgaaacttgagctccaccgcgccagtcacctgattgacgtcggggcg
ggaacgggaagcgtctcaattgaagcggcgctgcaatttccttcgttgcaggtgacggct
atcgagcgtaatcctgccgcactacggctgcttgatgagaatcgtcagcgctttgcctgc
ggcaatatcgatattctccccggcgaagcgccaatgaccataaccgggaaagccgatgcg
gtgtttatgggcggcagcggcggacatctgacggcgctgattgactgggcgatgggccat
ctgcatcccggtggccgtctggtgatgacctttatcttgcaggaaaaccttcatagcgcg
ctggcgcatcttgcgcacatcggcgcatgtcgaatggactgtgtacagcttcagctttca
tcgttaacgccgctgggggcggggcactatttcaaaccgaacaatcctgtttttgttatc
gcctgtcagaaggaagaaaaccatgtcagagacatttga

DBGET integrated database retrieval system