KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0922Help
Entry
SeSA_A0922        CDS       T00743                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00010  Glycolysis / Gluconeogenesis
sew00260  Glycine, serine and threonine metabolism
sew00680  Methane metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
sew01200  Carbon metabolism
sew01230  Biosynthesis of amino acids
Module
sew_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sew_M00002  Glycolysis, core module involving three-carbon compounds
sew_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeSA_A0922 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SeSA_A0922 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeSA_A0922 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sew04131]
    SeSA_A0922 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sew04147]
    SeSA_A0922 (gpmA)
Enzymes [BR:sew01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SeSA_A0922 (gpmA)
Membrane trafficking [BR:sew04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SeSA_A0922 (gpmA)
Exosome [BR:sew04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SeSA_A0922 (gpmA)
  Exosomal proteins of melanoma cells
   SeSA_A0922 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACF89470
UniProt: B4TQR7
LinkDB All DBs
Position
complement(892493..893245)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactacggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggcaacgctgacgagatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system