KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0923Help
Entry
SeSA_A0923        CDS       T00743                                 

Gene name
galM
Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00010  Glycolysis / Gluconeogenesis
sew00052  Galactose metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
Module
sew_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeSA_A0923 (galM)
   00052 Galactose metabolism
    SeSA_A0923 (galM)
Enzymes [BR:sew01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SeSA_A0923 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACF92860
UniProt: A0A0N1R196
LinkDB All DBs
Position
complement(893469..894509)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNSAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
HYPEQTSFLGASIGRYANRIANSRYTFAGETVQLSPSQGENQLHGGPEGFDKRRWQIVNQ
NDRQVLFALTSDDGDQGFPGHLCATAQYRLTDDNRISITYRATVDKPCPVNLTNHVYFNL
DGDRTDVRQHKLQILADEYLPVDESGIPRQGLKSVANTSFDFRMPKIIASEFLADDDQRK
VKGYDHAFLLQTQGDGKKPAARLWSQDGKLQMMVYTTAPALQFYSGNYLAGTPSRGPEPY
ADWQGLALESELLPDSPNHPEWPQPDCILRPGEEYASLTEYQFIPF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaatgaaacgcccgcactggcccccgatggtcaaccgtaccgcctgctaaccctg
cgcaacagcgcagggatggtggtaacgctgatggactggggagccactcttctttccgcc
cgtataccgctgtctgacggcagcgttcgggaagcattactgggctgcgccagcccggaa
cactaccctgaacagacgtcgttcctcggcgcctctattggccgttacgcgaaccgtatc
gccaatagccgctatacgtttgccggcgaaaccgtacagttaagcccaagccagggcgag
aaccagctacacggcggaccggaaggctttgacaagcgccgctggcaaattgtgaaccag
aacgatcgccaggtattattcgcgctcacctctgatgacggcgaccagggctttcctggc
catctttgcgccacggcgcaatatcgtctgaccgatgacaatagaatctccatcacctac
cgggcgacggtcgataaaccctgtccggtgaatttgaccaaccacgtctattttaatctg
gacggcgatcggaccgacgtgcgccagcataagctgcaaattctggcggatgagtatctg
ccggtagatgaatccggtattccacgccaggggctaaaatcggtagccaatacctcgttt
gacttccggatgccaaaaatcattgccagcgaatttctcgccgatgacgatcagcgcaag
gttaaaggctacgatcatgctttcctgctacagacgcagggtgatggcaaaaagccggcg
gcccgtctgtggtcacaggatggaaagctacaaatgatggtttacaccaccgccccggcg
ctacagttttattccggcaattatctggcgggtacaccttcccgcggaccggaaccttat
gccgactggcaagggctggcgctggagagcgaactgctgccggacagcccgaatcatcct
gaatggccgcagcctgactgtatccttcgccctggcgaggagtacgccagcctgaccgag
tatcagtttattccgttctaa

DBGET integrated database retrieval system