KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1015Help
Entry
SeSA_A1015        CDS       T00743                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00550  Peptidoglycan biosynthesis
sew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SeSA_A1015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sew01002]
    SeSA_A1015
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sew01011]
    SeSA_A1015
Enzymes [BR:sew01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SeSA_A1015
Peptidases and inhibitors [BR:sew01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SeSA_A1015
Peptidoglycan biosynthesis and degradation proteins [BR:sew01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SeSA_A1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CD52
Motif
Other DBs
NCBI-ProteinID: ACF89887
UniProt: A0A0N1TUR7
LinkDB All DBs
Position
988549..989829
Genome map
AA seq 426 aa AA seqDB search
MSALLLTALITRWCDVCFWNGYSGGTMTQYASSLRSLAAGSVLLFLFASPVKAEEQTIAP
PGVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVG
KDAWATGNPALRGSSVMFLKPGDQVSVADLNKGIIIQSGNDACIALADYVAGSQESFIGL
MNAYAKRLGLTNTTFQTVHGLDAPGQFSTARDMALLGKALIHDVPDEYAIHKEKEFTFNN
IRQPNRNRLLWSTNLHVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRIRFNES
EKLLTWGFRFFETVTPIKPDATFVTQRVWFGDKREVNLGAGDAGSVTIPRGQLKNLKASF
TLNEPQLTAPLKKGQVVGTIDFQLNGKSIEQRPLMVMENVEEGGFFSRMWDFVLMKLHQW
FGSWFS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcgttattactcaccgcacttattacacggtggtgtgacgtgtgtttttggaat
ggatactcgggtggtactatgacgcaatacgcttcttcccttcgtagcctcgcggcaggt
tcggttctcttattccttttcgcttcgcctgtaaaggcagaggaacaaacgatcgcgccg
ccgggcgttgatgcgcgagcctggatcttaatggattacgccagcggtaaagtactggcg
gaaggcaacgccgatgagaaactcgaccctgccagtttgacaaaaattatgaccagctac
gtggtgggccaggcgctgaaggcagggaaaatcaagctgaccgatatggtgacggtgggc
aaagatgcctgggcgacggggaacccggcgctacgtgggtcgtcggtgatgtttctgaag
ccaggcgatcaggtgtcggttgcggatcttaataaaggcatcatcattcagtcaggtaat
gatgcctgtatcgcgcttgccgactacgtcgccggaagccaggagtcctttatcggcctg
atgaacgcctatgcgaaacgactggggttaacgaatacaaccttccagacggtacacggt
cttgatgcgccagggcagttcagtaccgctcgcgatatggcgttgctcggcaaggccttg
attcacgatgtgcctgacgaatacgccattcataaagagaaagaatttacttttaataat
attcgtcaaccgaaccgcaaccgcctgttgtggagcaccaatctgcatgtcgacggcatg
aaaacggggacaacggcaggggctgggtataaccttgtcgcctccgccacccagggcgat
atgcgcctgatctctgtcgtgctgggggcgaaaacggaccgtattcgttttaatgagtca
gaaaaactgttgacctggggtttccgcttctttgaaacggtcacgccgattaaacctgac
gcgacattcgtgacgcaacgggtctggtttggcgataagcgtgaggtcaatttgggggcg
ggcgatgcggggtctgtgacgattccgcgtgggcagcttaaaaacctgaaggccagcttt
acgttgaacgaaccacagctcacggcgccgttgaagaaagggcaggttgtcggcaccatc
gatttccagcttaacggaaaatccattgagcaacgcccgttaatggtgatggaaaacgtc
gaggaggggggatttttcagccggatgtgggattttgtgctgatgaaactccatcagtgg
tttggcagttggttctcgtaa

DBGET integrated database retrieval system