KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1646Help
Entry
SeSA_A1646        CDS       T00743                                 

Definition
(GenBank) zinc-type alcohol dehydrogenase
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 DAO Peptidase_M55 Pyr_redox_3 Pyr_redox FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACF89967
UniProt: A0A0N1TUT1
LinkDB All DBs
Position
complement(1584768..1585793)
Genome map
AA seq 341 aa AA seqDB search
MKVKAVFINKPGEVETRWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEGAGMPDNIKKGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKIVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaacccgctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgctgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccacttgttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaaggcgccggaatgccggacaatattaaaaaa
ggcgaccgcgtgattgttgacccctatatttattgtggtcactgctacccttgctctgtc
ggcagaactaactgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcccgcacatttaattcataaaataccagataatgtaccttct
gaaatggcgccgctggcagaaccgctgaccatcgctctgcacgcgctgcatcgggcaaac
gttaaggccggggaatatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgtcattacaaggcaacgcctattctgatcgatattgtggaagaaaggcta
cgctatgcgcaaaagcttggcgttccctatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcttccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctacaaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgcatgctgtca
acgctggagattaatccgcaagatgttgtcagtaagatcgtcaatcttgatgagatccct
gatgcagttaaagagcttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system