KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3450
Entry
SeSA_A3450        CDS       T00743                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00052  Galactose metabolism
sew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SeSA_A3450
Enzymes [BR:sew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SeSA_A3450
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 MTS TrkA_N 2-Hacid_dh_C 3HCDH_N Shikimate_DH Methyltransf_31 PrmA UDPG_MGDP_dh_N Met_10 Methyltransf_11 Pyr_redox_2 Sacchrp_dh_NADP CoA_binding ELFV_dehydrog Pyr_redox Methyltransf_24 Fer4_4
Other DBs
NCBI-ProteinID: ACF88726
UniProt: A0A0N1QS66
LinkDB
Position
3332157..3333200
AA seq 347 aa
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCRQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSGIQFDQLVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLTPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgcgttgaagaacgccccttacca
caactgcaagccgaggacgatgtgttggtcaaagtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggccatgaa
ttcagcggctacgtagaatcctacggcacaggcgtaacggatatgcagcccggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcactgtccgcaatgcgaacgcggttacttt
tctttatgcagacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccgtctgatatgccgattgaagatggc
gcgtttatcgaaccgattaccgtgggcttacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgtcggtgccgggacaattggcctgctggccttacaatgcgcg
cgggaactgggcgctcgaagcgtaacggcgattgatatcaatccgcagaaactggaactg
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
cagaccgcgttgtccggcattcagtttgatcaactggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcgccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacaacgcgtacattcggattaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaagaatgggaa
accgcagcgcgcctgttggctgaaaaacgtcttcaactgacccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaatcttacttcaactttcctga

DBGET integrated database retrieval system