KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3535Help
Entry
SeSA_A3535        CDS       T00743                                 

Gene name
sspA
Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sew03021]
    SeSA_A3535 (sspA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sew02000]
    SeSA_A3535 (sspA)
Transcription machinery [BR:sew03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     SeSA_A3535 (sspA)
Transporters [BR:sew02000]
 Other Transporters
  Pores ion channels [TC:1]
   SeSA_A3535 (sspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_5 Glutaredoxin GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACF91409
UniProt: A0A0N1QY45
LinkDB All DBs
Position
complement(3409685..3410323)
Genome map
AA seq 212 aa AA seqDB search
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNVIVNG
SASEADSARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGAGA
KELKGYMTRVFERDSFLASLTEAEREMRLGRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgccaacaaacgttcggtaatgacgctgttttctggtcctactgacatc
tatagccatcaggtccgcattgtgttggctgaaaagggtgttagttttgagatcgaacat
gtggaaaaggacaatccacctcaggatctgattgacctcaacccgaaccaaagcgttccg
acactggtggatcgtgagctgaccctgtgggaatctcgcatcattatggaatatctggat
gagcgtttccctcatccgccgctgatgccggtttatccggtcgcgcgcggtgaaagccgt
ctgtacatgcaccgtattgaaaaagactggtatacgctgatgaacgtcatcgtaaacggg
tctgcttccgaggccgactctgcgcgtaaacaactgcgtgaagagctgctggcgattgcg
ccggtatttggtcagaaaccgtattttctgagcgacgaattcagcctggttgattgttac
ctggcgcctctcctgtggcgtttaccgcagttgggtatcgaattcagcggcgcaggggcg
aaagagctgaaaggctatatgacccgcgtctttgaacgtgattctttcctggcttcttta
accgaagctgaacgtgaaatgcgcctcggtcggggttaa

DBGET integrated database retrieval system