KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3572Help
Entry
SeSA_A3572        CDS       T00743                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00061  Fatty acid biosynthesis
sew00620  Pyruvate metabolism
sew00640  Propanoate metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
sew01200  Carbon metabolism
sew01212  Fatty acid metabolism
Module
sew_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeSA_A3572 (accC)
   00640 Propanoate metabolism
    SeSA_A3572 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SeSA_A3572 (accC)
Enzymes [BR:sew01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SeSA_A3572 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SeSA_A3572 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACF91805
UniProt: A0A0N1QYT2
LinkDB All DBs
Position
3448781..3450130
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGDDMNANRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSITQDEVVVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNIDL
QTRIMNDEHFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaaattgtcatcgccaaccgcggcgagatcgcattacgtattcttcgagcc
tgtaaagaactcggcatcaagaccgtcgctgtgcactcaagcgcggatcgcgatttaaaa
cacgtattgctggcggatgagacggtctgtattggcccggcaccgtccgtaaaaagttat
ctgaacatcccggctatcattagtgccgctgaaatcaccggcgcggtggcaatccacccg
ggttacggcttcctttctgagaacgccaattttgccgagcaggttgaacgctccggcttt
atctttatcggcccgaaagcggacaccatccgcctgatgggcgataaagtgtccgcgatt
accgcgatgaaaaaagcgggcgtgccgaccgtaccaggatctgacggcccgctgggcgac
gatatgaatgcgaaccgcgctcatgccaaacgtattggctatccggtgatcatcaaagcg
tccggcggcggcggcggccgcggtatgcgcgtggttcgtagcgatgctgaactggcgcag
tccatctccatgaccaaagcggaagcgaaagcggctttcagcaacgacatggtatacatg
gaaaaatacctggaaaatccacgccacatcgaaattcaggtgctggcggacggccagggc
aacgctatctatctggcggaacgcgactgttccatgcagcgtcgccaccagaaagtggtt
gaagaagccccggcgccaggcattacgccggaactgcgtcgctatatcggcgaacgctgc
gcgaaagcgtgcgtagacatcggctatcgcggcgcagggacgttcgaattcctgttcgaa
aacggcgagttctatttcatcgaaatgaacacccgtattcaggttgaacacccggtgact
gaaatgattaccggcgtcgatttgatcaaagagcagttgcgcatcgcggcgggtcagccg
ctgtcgatcacacaggacgaagttgtcgttcgaggccatgcggtagaatgccgtatcaat
gccgaagatccgaacaccttcctgccaagccctggcaaaatcacgcgcttccatgcgcct
ggcggctttggcgttcgctgggaatctcatatctacgcgggctacacggtgccgccgtac
tatgattccatgatcggcaaactcatctgctacggtgaaaaccgcgacgtggcgattgcc
cgtatgaaaaatgccctgcaggaactgattatcgatggtatcaaaaccaatatcgatctg
cagacccgcatcatgaatgacgaacacttccagcacggtggaactaacatccactatctg
gagaaaaaactcggtcttcaggaaaagtaa

DBGET integrated database retrieval system