KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_1500Help
Entry
STBHUCCB_1500     CDS       T01741                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00473  D-Alanine metabolism
sex00550  Peptidoglycan biosynthesis
sex01100  Metabolic pathways
sex01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    STBHUCCB_1500
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STBHUCCB_1500
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    STBHUCCB_1500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sex01011]
    STBHUCCB_1500
Enzymes [BR:sex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     STBHUCCB_1500
Peptidoglycan biosynthesis and degradation proteins [BR:sex01011]
 Precursor biosynthesis
  Amino acid ligase
   STBHUCCB_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEZ43910
LinkDB All DBs
Position
154025..154945
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENALQGALSLAFQHDDEILIE
KWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLEASQEAALQSL
VLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtcctgttgggcggaacctctgcggagcgggacgtttcgtta
aattccggcgcggcagtgttggccgggttacgtgaaggcggtattgatgcgcatcccgtc
gatccgcaagaggtcgatgtcgcgcagcttaaagcaatgggctttcagaaggtctttatt
gcgttgcatggccgcggcggtgaagatggcaccttacagggaatgcttgaactgctcggc
ctgccttataccggcagcggcgtgatggcctcggcgctttccatggataaactgcgcagt
aaattgctgtggcagggcgcaggcttaccggttgcgccgtgggtcgcgctgacgcgcgct
gagtttgaaaaaggccttagcgaagaacaaaaagcgcgaatttcggcgctgggtttaccg
ctgatcgtcaaacccagccgtgaaggctccagcgtcggtatgacgaaagtagtagaagaa
aatgctttacagggtgcgttatcattggcttttcagcatgatgacgaaatactgattgag
aaatggctgtgcggtccggaatttacggtggcgatagttggcgaagaaattttaccgtca
attcgtatccaaccggcaggaaccttctatgattatgaggcgaagtatctctctgatgag
actcagtatttctgccctgccggtttagaagcgtcccaggaagccgcgctacagtctctc
gtcctgcaggcatggaaagctttaggctgcacgggatgggggcgtattgacgtcatgctg
gacagcgatggtcagttttatctgctggaagccaatacttctccggggatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggaatgagcttctcgcagttagtggtacga
attctggagttggcggactga

DBGET integrated database retrieval system