KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_6200Help
Entry
STBHUCCB_6200     CDS       T01741                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00564  Glycerophospholipid metabolism
sex01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    STBHUCCB_6200
Enzymes [BR:sex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     STBHUCCB_6200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DAO_C Thi4 3HCDH_N HI0933_like NAD_binding_8 Lycopene_cycl Pyr_redox_3 FtsA SO_alpha_A3 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEZ44360
LinkDB All DBs
Position
complement(655182..656810)
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDGLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPSDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaagcaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgcgactgcgcgctgcgcggtttacgtgtcattctggtggagcggcat
gatatagcgaccggcgcgaccgggcgtaaccacgggctgctgcacagcggcgctcgttat
gcggttaccgacgcggaatccgcgcgcgagtgcattagtgaaaaccagattttaaaacgg
atcgcccgccattgcgtcgaaccgacggatggtctgtttattacgttgccggaagatggt
cttgcgtttcaggccacctttattcgcgcctgtgaagcggcaggcattcgcgctgaagcc
atcgatccgcagcaggctcgcatcatcgaaccttccgttaaccctgcgctcatcggtgcg
gtaaaagtgccggatggcaccgtagaccctttccgcctgaccgccgccaatatgctggat
gccagagaacatggcgcaatcgtgttaacggcgcatgaagtgaccgggctcattcgtgaa
ggcgcaacggtctgcggcgtccatgtgcgtaaccatctcactggcgaaacccagacgctt
cacgcgccggtggtggtcaatgcggctggtatctgggggcaacggatcgccgaatacgcc
gacctgagtattcgcatgttcccggcgaaaggctcgctgttgatcatggaccatcggatc
aaccagcatgtcattaaccgctgccggaaaccatcggatgccgacattctggtacctagc
gatacgatttcactgatcggcaccacctctacccatattgattacaatgagatagacagc
aaccgcgtcaccgcagatgaagtcgatatcctgctgcgtgaaggggaaaaactggcccct
gtcatggcgaagacacgtattctgcgcgcgtattccggcgtccgcccgctggtggccagc
gatgacgatcccagcggtcgtaacgtcagccgcggtattgtgttgttcgaccacgccgaa
cgcgacgggcttgatggcttcattactattaccggcgggaagctaatgacttatcgcctg
atggcggaatgggcgaccgacgccgtgtgccgcaagttgggcaatactcgcccctgcatc
acggcggatacgccgttgcctggctcaaaagagtctacggaacatacgctgaaacgcatt
atctcgcttcccgcgccgctacgcggatcggcggtttatcggcatggcgatcgcacgccg
gggtggctgagtgaaggccgccaacaccgtagcctggtctgtgaatgcgaggccgtcacg
gcgggggaagtgcagtatgccgtcgaaaacttaaccgtgaatagcctgctggatctgcgc
cgtcgcacccgcgtagggatgggcacttgccagggcgaactgtgcgcctgccgcgcggcc
gggctattgcagcgttttaatgtgacgaccgcggcgcaatctattacgcaactctctgaa
tttctgaatgagcgctggaaaggcgtacaacctgtcgcctggggagacgcgctgcgcgaa
agcgaattcacgcgctgggtttatcagggattatgcggtctggagaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system