KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0130Help
Entry
SL1344_0130       CDS       T01724                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00473  D-Alanine metabolism
sey00550  Peptidoglycan biosynthesis
sey01100  Metabolic pathways
sey01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SL1344_0130 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SL1344_0130 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SL1344_0130 (ddlB)
Enzymes [BR:sey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SL1344_0130 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:sey01011]
 Precursor biosynthesis
  Amino acid ligase
   SL1344_0130 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CBW16233
UniProt: A0A0H3N7K6
LinkDB All DBs
Position
152614..153534
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGINAHPVDPQEVDVAQLKAMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENALQGALSLAFQHDDEILIE
KWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLDASQEAALQSL
VLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtcctgttgggcggaacctctgcggagcgggacgtttcgtta
aattccggcgcggcagtgttggccgggctacgtgaaggcggcattaatgcgcatcccgtc
gatccgcaagaggtcgatgtcgcgcagcttaaagcaatgggctttcagaaggtctttatt
gcgttgcatggccgtggcggtgaagatggcaccttacagggaatgcttgaactgctcggc
ctgccttataccggtagcggcgtgatggcctcggcgctttccatggataaactgcgcagt
aaattgctgtggcagggcgcaggcttaccggttgcgccgtgggtcgcgctgacgcgcgct
gagtttgaaaaaggtcttagcgaagaacaaaaagcgcgaatttcggcgctgggtttaccg
ctgatcgtcaaacccagccgtgaaggctccagcgtcggtatgacgaaagtagtagaagaa
aatgctttacagggtgcgttatcattggcttttcagcatgatgacgaaatactgattgag
aaatggctgtgcggtccggaatttacagtggcgatagttggcgaagaaattttaccgtca
attcgtatccaaccggcaggaaccttctatgattatgaggcgaagtatctctctgatgag
actcagtatttctgccctgccggtttagatgcgtcccaggaagccgcgctacagtctctc
gtcctgcaggcatggaaagctttaggctgcacgggatgggggcgtattgacgtcatgctg
gacagcgatggtcagttttatctgctggaagccaatacttctccggggatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggaatgagcttctcgcagttagtggtacga
attctggagttggcggactga

DBGET integrated database retrieval system