KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0159Help
Entry
SL1344_0159       CDS       T01724                                 

Gene name
acnB
Definition
(GenBank) aconitate hydratase 2 (citrate hydro-lyase 2)
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00020  Citrate cycle (TCA cycle)
sey00630  Glyoxylate and dicarboxylate metabolism
sey00640  Propanoate metabolism
sey01100  Metabolic pathways
sey01110  Biosynthesis of secondary metabolites
sey01120  Microbial metabolism in diverse environments
sey01200  Carbon metabolism
sey01210  2-Oxocarboxylic acid metabolism
sey01230  Biosynthesis of amino acids
Module
sey_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sey_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sey_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL1344_0159 (acnB)
   00630 Glyoxylate and dicarboxylate metabolism
    SL1344_0159 (acnB)
   00640 Propanoate metabolism
    SL1344_0159 (acnB)
Enzymes [BR:sey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     SL1344_0159 (acnB)
    4.2.1.99  2-methylisocitrate dehydratase
     SL1344_0159 (acnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: CBW16261
UniProt: A0A0H3N962
LinkDB All DBs
Position
185853..188450
Genome map
AA seq 865 aa AA seqDB search
MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEFLLDLLINRVPPGVDEA
AYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPLIDALDDAKLAPIAAKALS
HTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLAEKITVTVFKVTGETNTD
DLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQIEALQKKGYPLAYVGDVV
GTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVDVSN
LNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKAREA
LGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVKGIRPGAYCEPKMTSVGSQDTTGPM
TRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHHTLPDFIMNRGGVSLRPGDGVIH
SWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGKM
QPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSGRILEIEGLPDLKVEQAFELTDASA
ERSAAGCTIKLNKEPIVEYLTSNIVLLKWMIAEGYGDRRTLERRIQGMEKWLADPQLLEA
DADAEYAAVIDIDLADIKEPILCAPNDPDDARLLSDVQGEKIDEVFIGSCMTNIGHFRAA
GKLLDNHKGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARVA
DGATVVSTSTRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAVDT
YRYLNFDQLSQYTEKADGVIFQTAV
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
gtgctagaagaataccgtaagcacgtagctgagcgtgctgcccaggggattgtgccaaaa
cctttagacgcaacccaaatggctgcgcttgtcgagctgctgaagaccccgcctgtgggc
gaagaagaattcctgttagacctgttgatcaaccgcgttcctcctggcgtagatgaagcc
gcttatgttaaagccggttttctcgctgctgtcgcgaaaggcgacaccacctccccgctg
gtctccccagaaaaagccattgaactgctgggcaccatgcagggtggttacaacattcat
ccgctgattgatgcgctggacgatgcgaaactggcgccgattgctgccaaagcactgtcc
cacaccctgctgatgttcgataacttctacgacgtagaagagaaagccaaagcgggcaat
gaatatgccaaacaggtgatgcaatcctgggccgacgccgaatggttcctgagccgtccg
ccgctggcggaaaaaatcaccgtcaccgttttcaaagtgaccggcgaaacgaataccgac
gatctctctccggcgccggatgcgtggtcgagaccggatatcccgttacatgcgcaggcg
atgctgaaaaacgcccgtgaaggcattgagccggatcagccaggcgttgtcggcccgatc
aaacaaatcgaagcattgcagaaaaaaggctacccgctggcttacgtgggtgacgtggtg
ggcaccggttcttcccgtaaatccgcgaccaactccgtgctgtggttcatgggcgatgac
atcccgaacgtgccgaataagcgcggcggcggtctgtgcctcggcggcaaaattgcgcct
atcttctttaacactatggaagatgcgggcgcgctgccgattgaagttgacgtttctaac
ctgaatatgggcgatgtgattgacgtctacccgtacaaaggcgaagtacgcaatcatgaa
accggcgagctactggcaaccttcgaactgaaaaccgacgtgctgattgacgaagtgcgt
gccggtggtcgtattccgctgattatcggccgtggcctgaccaccaaagcgcgtgaagcg
ctggggctgccgcactcagacgttttccgtcaggcaaaagacgtggcggaaagcagccgt
ggcttctcgctggcacagaaaatggtcggtcgcgcctgtggtgtgaaaggtatccgtccg
ggcgcgtactgcgaaccgaaaatgacctccgtcggttctcaggatactaccggcccgatg
acccgcgacgagctgaaagacctggcctgtctgggattctccgccgatctggtcatgcag
tcgttctgtcacaccgcagcctatccgaagccggttgacgtcaccacgcaccacacgctg
ccagacttcattatgaaccgtggcggtgtctctctgcgtccgggcgacggcgtgattcac
tcctggctgaaccgtatgctgctgccggataccgtcggtaccggcggtgactcccatacc
cgtttcccgattggtatctctttcccggcgggttctggtctggtggcgtttgccgccgcg
accggcgtgatgccgctggatatgccggaatccgtgctggtgcgcttcaaaggcaaaatg
cagccgggcatcaccctgcgcgatctggtacacgccatcccgctgtacgccatcaaacag
ggcctgctgaccgttgagaagaaaggcaagaaaaacatcttctctggccgcatcctggaa
atcgaaggtctgccggatctgaaagtcgagcaggcgtttgagctgaccgatgcttccgcc
gagcgttccgctgccggttgtaccatcaagctgaacaaagagccgattgttgaatacctg
acctccaacatcgtcctgctgaagtggatgatcgccgaaggctacggcgaccgccgtacg
ctggaacgtcgtatccagggcatggaaaaatggctggcggacccgcagctgctggaagcc
gatgctgacgcagagtacgcggcggtgatcgacatcgatctggcggatatcaaagagcca
atcctctgtgcgccgaacgatccggacgacgcgcgtctgctgtctgacgtgcagggcgag
aagatcgacgaagtgttcatcggctcctgcatgactaacatcggccacttccgtgcagcc
ggcaagctgctggacaaccataaaggccaactgccgactcgcctgtgggtggcgccgcca
acccgtatggacgccgcgcagctgaccgaagaaggttactacagcgtgttcggtaagagc
ggtgcgcgtattgagatccctggctgttccctgtgtatgggtaaccaggcgcgtgtggct
gacggtgcgacggtggtttccacttctacccgtaacttcccgaaccgtttaggtaccggt
gcgaacgtcttcctggcttctgcggagctggcggcggttgcggcgctgatcggcaaactg
ccgacgccggaagagtaccagacctacgtggcacaggtggataagacggcggtggatact
taccgttacctgaactttgaccagctttctcagtacaccgagaaagcagatggcgtgatt
ttccagactgcggtttaa

DBGET integrated database retrieval system